Basic Vector Information
- Vector Name:
- FA(1)_HQN
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3852 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Groseclose TM, Rondon RE, Herde ZD, Aldrete CA
FA(1)_HQN vector Map
FA(1)_HQN vector Sequence
LOCUS 62056_711 3852 bp DNA circular SYN 10-SEP-2020
DEFINITION Cloning vector FA(1)_HQN, complete sequence.
ACCESSION MT127345
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3852)
AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ.
TITLE Engineered systems of inducible anti-repressors for the next
generation of biological programming
JOURNAL Nat Commun 11 (1), 4440 (2020)
PUBMED 32895374
REFERENCE 2 (bases 1 to 3852)
AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ.
TITLE Direct Submission
JOURNAL
REFERENCE 3 (bases 1 to 3852)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "4440"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(28-FEB-2020) Chemical "
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..3852
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 596..673
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 674..1678
/codon_start=1
/transl_table=11
/product="FA(1)_HQN"
/label=FA
/protein_id="QLY89207.1"
/translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKSSRSIGLVIPDLENTSYSRFANYLERQARQRGYQLKIACSEDQPD
NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGQNELLDF
LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
protein_bind 1808..1829
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin 2020..2564
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 3090..3192
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 3193..3849
/label=CmR
/note="chloramphenicol acetyltransferase"
This page is informational only.