pRNBZMB vector (V015690)

LOCUS       62056_18955        3773 bp DNA     circular SYN 10-APR-2019
DEFINITION  Cloning vector pRNBZMB, complete sequence.
ACCESSION   MH507507
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3773)
  AUTHORS   Kumar D, Batra J, Komives C, Rathore AS.
  TITLE     QbD Based Media Development for the Production of Fab Fragments in 
            E. coli
  JOURNAL   Bioengineering (Basel) 6 (2), E29 (2019)
  PUBMED    30925730
REFERENCE   2  (bases 1 to 3773)
  AUTHORS   Kumar D, Batra J, Komives C, Rathore AS.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JUN-2018) Chemical Engineering, Indian Institute of 
            Technology Delhi, Lab-94, Block-II, Hauz Khas, New Delhi, Delhi 
            110016, India
REFERENCE   3  (bases 1 to 3773)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Bioengineering (Basel)"; date: "2019"; volume: "6"; issue: "2"; 
            pages: "E29"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-JUN-2018) Chemical Engineering, Indian Institute of Technology 
            Delhi, Lab-94, Block-II, Hauz Khas, New Delhi, Delhi 110016, India"
FEATURES             Location/Qualifiers
     source          1..3773
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             1..774
                     /codon_start=1
                     /transl_table=11
                     /product="Mal/Ranibizumab heavy chain"
                     /label=Mal/Ranibizumab heavy chain
                     /note="optimized for E. coli. expression"
                     /protein_id="QBW95968.1"
                     /translation="MKIKTGARILALSALTTMMFSASALAEVQLVESGGGLVQPGGSLR
                     LSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKST
                     AYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPS
                     SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
                     SSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHL"
     sig_peptide     813..878
                     /label=pelB signal sequence
                     /note="leader peptide for secretion"
     CDS             1203..1520
                     /label=hIg-kappa-CL
                     /note="Human immunoglobulin kappa light chain constant
                     region"
     terminator      1555..1602
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     terminator      1700..1729
                     /label=T3Te terminator
                     /note="phage T3 early transcription terminator"
     rep_origin      1759..2304
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     terminator      complement(2569..2596)
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     CDS             complement(2623..3429)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     promoter        complement(3430..3520)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     promoter        3624..3742
                     /label=rhaB promoter
                     /note="promoter of the E. coli rhaBAD operon, conferring
                     tight induction with L-rhamnose and repression with 
                     D-glucose in the presence of RhaR and RhaS (Giacalone et 
                     al., 2006)"