L4440-2XproD-gtwy vector (V015665)

MSDS

Basic Vector Information

Vector Name:: L4440-2XproD-gtwy

Antibiotic Resistance:: Ampicillin

Length:: 4705 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Velasco L.

Promoter:: lac UV5

L4440-2XproD-gtwy vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

L4440-2XproD-gtwy vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_1390        4705 bp DNA     circular SYN 12-MAY-2021
DEFINITION  Cloning vector L4440-2XproD-gtwy, complete genome.
ACCESSION   MT333852
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4705)
  AUTHORS   Velasco L.
  TITLE     An efficient dsRNA constitutive expression system for bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4705)
  AUTHORS   Velasco L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de 
            Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la 
            Cruz s/n, Churriana, Malaga 29140, Spain
REFERENCE   3  (bases 1 to 4705)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y
            Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, 
            Churriana, Malaga 29140, Spain"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4705
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        587..605
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      616..775
                     /label=proD
                     /note="proD"
                     /regulatory_class="promoter"
     protein_bind    783..907
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        932..962
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     gene            1016..1696
                     /gene="cat"
                     /label=cat
     CDS             1016..1696
                     /codon_start=1
                     /transl_table=11
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=cat
                     /note="CAT marker"
                     /protein_id="QUV72827.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNEYNSTAMSGRAGRKRV
                     DPAY"
     CDS             2015..2317
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(2361..2485)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     primer_bind     complement(2500..2516)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(2706..2724)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2734..2750)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      2892..3347
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        3373..3477
                     /label=AmpR promoter
     CDS             3478..4335
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4509..4705
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.