pCasCure-Rif vector (V015527)

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V015527 pCasCure-Rif In stock, 1 week for quality controls

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

pCasCure-Rif plasmid containing the Cas9 gene with an l-arabinose inducible promoter pBAD, the sgRNA with the synthetic J23119 promoter, and the sacB gene for plasmid self-curing. F and R denote the locations of primers used for the sgRNA construct.

Vector Name:
pCasCure-Rif
Length:
9764 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Chen L.
Promoter:
araBAD

pCasCure-Rif vector Map

pCasCure-Rif9764 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600AmpR promoterM13 fwdKS primerSacBJ23119(SpeI) promotergRNA scaffoldSK primerCas9araBAD promoteraraCM13 revlac operatorlac promoterCAP binding siteoriArr

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Hao M, He Y, Zhang H, et al. CRISPR-Cas9-Mediated Carbapenemase Gene and Plasmid Curing in Carbapenem-Resistant Enterobacteriaceae. Antimicrob Agents Chemother. 2020;64(9):e00843-20. Published 2020 Aug 20. doi:10.1128/AAC.00843-20

pCasCure-Rif vector Sequence

LOCUS       62056_4905        9764 bp DNA     circular SYN 26-MAY-2020
DEFINITION  Cloning vector pCasCure-Rif, complete sequence.
ACCESSION   MT262893
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9764)
  AUTHORS   Chen L.
  TITLE     CRISPR/Cas9-mediated plasmid curation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9764)
  AUTHORS   Chen L.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-2020) Center for Discovery and Innovation, 
            Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110, 
            USA
REFERENCE   3  (bases 1 to 9764)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (27-MAR-2020) Center for Discovery and Innovation, 
            Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110, 
            USA"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..9764
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(1..105)
                     /label=AmpR promoter
     primer_bind     579..595
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     633..649
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(714..2132)
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     promoter        2518..2552
                     /label=J23119(SpeI) promoter
                     /note="bacterial promoter (Registry of Standard Biological
                     Parts BBa_J23119) modified to end with an SpeI site"
     misc_RNA        2570..2645
                     /label=gRNA scaffold
                     /note="guide RNA scaffold for the Streptococcus pyogenes 
                     CRISPR/Cas9 system"
     primer_bind     complement(2678..2694)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(2707..6810)
                     /label=Cas9
                     /note="Cas9 (Csn1) endonuclease from the Streptococcus
                     pyogenes Type II CRISPR/Cas system"
     promoter        complement(6838..7122)
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     CDS             7149..8024
                     /label=araC
                     /note="L-arabinose regulatory protein"
     primer_bind     complement(8151..8167)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(8175..8191)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8199..8229)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8244..8265)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(8553..9141)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9312..9764)
                     /codon_start=1
                     /transl_table=11
                     /product="Arr"
                     /label=Arr
                     /protein_id="QJX58432.1"
                     /translation="MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDG
                     RILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDDPNLTNKRFPGNPT
                     QSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED"