Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V015527 | pCasCure-Rif | In stock, 1 week for quality controls |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pCasCure-Rif plasmid containing the Cas9 gene with an l-arabinose inducible promoter pBAD, the sgRNA with the synthetic J23119 promoter, and the sacB gene for plasmid self-curing. F and R denote the locations of primers used for the sgRNA construct.
- Vector Name:
- pCasCure-Rif
- Length:
- 9764 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chen L.
- Promoter:
- araBAD
pCasCure-Rif vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Hao M, He Y, Zhang H, et al. CRISPR-Cas9-Mediated Carbapenemase Gene and Plasmid Curing in Carbapenem-Resistant Enterobacteriaceae. Antimicrob Agents Chemother. 2020;64(9):e00843-20. Published 2020 Aug 20. doi:10.1128/AAC.00843-20
pCasCure-Rif vector Sequence
LOCUS 62056_4905 9764 bp DNA circular SYN 26-MAY-2020
DEFINITION Cloning vector pCasCure-Rif, complete sequence.
ACCESSION MT262893
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9764)
AUTHORS Chen L.
TITLE CRISPR/Cas9-mediated plasmid curation
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9764)
AUTHORS Chen L.
TITLE Direct Submission
JOURNAL Submitted (27-MAR-2020) Center for Discovery and Innovation,
Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110,
USA
REFERENCE 3 (bases 1 to 9764)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-MAR-2020) Center for Discovery and Innovation,
Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110,
USA"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..9764
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(1..105)
/label=AmpR promoter
primer_bind 579..595
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
primer_bind 633..649
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(714..2132)
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
promoter 2518..2552
/label=J23119(SpeI) promoter
/note="bacterial promoter (Registry of Standard Biological
Parts BBa_J23119) modified to end with an SpeI site"
misc_RNA 2570..2645
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
primer_bind complement(2678..2694)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(2707..6810)
/label=Cas9
/note="Cas9 (Csn1) endonuclease from the Streptococcus
pyogenes Type II CRISPR/Cas system"
promoter complement(6838..7122)
/label=araBAD promoter
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
CDS 7149..8024
/label=araC
/note="L-arabinose regulatory protein"
primer_bind complement(8151..8167)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(8175..8191)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(8199..8229)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(8244..8265)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(8553..9141)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(9312..9764)
/codon_start=1
/transl_table=11
/product="Arr"
/label=Arr
/protein_id="QJX58432.1"
/translation="MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDG
RILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDDPNLTNKRFPGNPT
QSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED"