pBla_gg vector (V015449)

LOCUS       62056_4080        2667 bp DNA     circular SYN 16-JUN-2021
DEFINITION  Cloning vector pBla_gg, complete sequence.
ACCESSION   MW816823
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2667)
  AUTHORS   Hashimoto K, Fischer EC, Romesberg FE.
  TITLE     Efforts toward Further Integration of an Unnatural Base Pair into 
            the Biology of a Semisynthetic Organism
  JOURNAL   J Am Chem Soc (2021) In press
  PUBMED    34096294
REFERENCE   2  (bases 1 to 2667)
  AUTHORS   Hashimoto K.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAR-2021) Department of Chemistry, The Scripps 
            Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 
            92037, USA
REFERENCE   3  (bases 1 to 2667)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Am Chem 
            Soc (2021) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (25-MAR-2021) Department of Chemistry, The Scripps Research 
            Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..2667
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      109..654
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        807..911
                     /label=AmpR promoter
     RBS             926..948
                     /label=RBS
                     /note="efficient ribosome binding site from bacteriophage
                     T7 gene 10 (Olins and Rangwala, 1989)"
     gene            957..1787
                     /gene="bla"
                     /label=bla
     CDS             join(957..1134,1153..1787)
                     /codon_start=1
                     /transl_table=11
                     /gene="bla"
                     /product="beta-lactamase TEM-1"
                     /label=bla
                     /protein_id="QWO78781.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLDSGKILESFRRAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
                     CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTT
                     MPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGER
                     GSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW"
     misc_feature    1130..1134
                     /gene="bla"
                     /label=UBP
                     /note="UBP"
     misc_feature    1135..1140
                     /gene="bla"
                     /label=BsaI
                     /note="BsaI"
     misc_feature    1141..1146
                     /gene="bla"
                     /label=KpnI
                     /note="KpnI"
     misc_feature    1147..1152
                     /gene="bla"
                     /label=BsaI
                     /note="BsaI"
     misc_feature    1153..1159
                     /gene="bla"
                     /label=UBP
                     /note="UBP"
     misc_feature    1819..1854
                     /label=proK terminator
                     /note="proK terminator"
     promoter        1884..1914
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     misc_feature    1926..1932
                     /label=5' leader from serT
                     /note="5' leader from serT"
     misc_feature    1933..1994
                     /label=tRNA Ser(UGA)
                     /note="tRNA Ser(UGA)"
     misc_feature    1947..1952
                     /label=BsaI
                     /note="BsaI"
     misc_feature    1953..1958
                     /label=KpnI
                     /note="KpnI"
     misc_feature    1959..1964
                     /label=BsaI
                     /note="BsaI"
     misc_feature    1995..2037
                     /label=3' UTR from serT
                     /note="3' UTR from serT"
     misc_feature    2038..2073
                     /label=proK terminator
                     /note="proK terminator"
     promoter        2121..2168
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             2187..2558
                     /label=BleoR
                     /note="antibiotic-binding protein"
     terminator      2573..2667
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"