Basic Vector Information
- Vector Name:
- pMYC21
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7489 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Host:
- Yeast
- Source/Author:
- Gross S, Schnell B, Haack P, Auerbach D
- Promoter:
- URA3
pMYC21 vector Map
pMYC21 vector Sequence
LOCUS 62056_17685 7489 bp DNA circular SYN 10-FEB-2021
DEFINITION Cloning vector pMYC21, complete sequence.
ACCESSION MT572318
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7489)
AUTHORS Gross S, Schnell B, Haack P, Auerbach D, Mueller R.
TITLE In vivo and in vitro reconstitution of unique key steps in
cystobactamid antibiotic biosynthesis
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7489)
AUTHORS Gross S, Schnell B, Haack P, Auerbach D, Mueller R.
TITLE Direct Submission
JOURNAL Submitted (04-JUN-2020) Microbial Natural Products, Helmholtz
Institute for Pharmaceutical Research Saarland, Helmholtz Center for
Infection Research, Saarland University Campus E8.1, Saarbruecken,
Saarland 66123, Germany
REFERENCE 3 (bases 1 to 7489)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(04-JUN-2020) Microbial Natural Products, Helmholtz Institute for
Pharmaceutical Research Saarland, Helmholtz Center for Infection
Research, Saarland University Campus E8.1, Saarbruecken, Saarland
66123, Germany"
FEATURES Location/Qualifiers
source 1..7489
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 28..248
/label=URA3 promoter
CDS 249..1049
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
rep_origin 1166..1711
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 2079..2181
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 2182..2838
/label=CmR
/note="chloramphenicol acetyltransferase"
repeat_region 3052..3080
/label=from Himar1
/note="from Himar1"
oriT 3230..3339
/label=oriT
/note="incP origin of transfer"
CDS 3372..3740
/label=traJ
/note="oriT-recognizing protein"
misc_feature 3812..4315
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
misc_feature 4593..6421
/label=mx9 int building block
/note="mx9 int building block"
gene 4770..6416
/gene="int"
/label=int
CDS 4770..6416
/codon_start=1
/transl_table=11
/gene="int"
/product="Int"
/label=int
/note="site specific recombinase"
/protein_id="QRG42414.1"
/translation="MALRGASDATTNPSRLVQSVAAGPRATPWGVSASWYLLGRTATGE
YIVSSDAAKKGHPMATAAERLPTSPIDVNALALEVARLVALQQQSATPPSSGRTFGAVA
DDWLITEAKRLVCPDNERRHLRHMEALWGMTDVELTPRVVKAHLAGLLKPEGPLSAATV
NKVRSTGKRIIKAAQINGEWGPVNPFGVLDREKEAKAERLTLTAAECRAVLPHFRADRR
REFLFQVFLGPRPGEEKALLKEDVDVEARTVIFRRSNGRDTTKTGRERRVPVPDELWPV
LLDAMQASPSDLVFPNAKGERQRADTKMTRVLRTALSAAGVVVGWDYICRTQGCGYRDV
QSGGARQERRCPACDKRMWASGRPKPAVWYGLRHTAATLHRKAGCDPLVIKLVLGHAAV
DTTDDVYTHLDEDYCRAELNKLSLKAPPPPPTHQGGSDGGPDSGRNTYGEGGTMHGLGD
LQHHRARAWEARALPTELPPRNLAGGIPAPLLSVKDVAASLSVSTAKVYQLLAAGVLPT
VWVGQSRRVKREDLDAYIARATATGGKRGGK"
misc_feature 5560..5591
/gene="int"
/label=attP
/note="attP"
regulatory 6473..6546
/label=kanR promoter
/note="kanR promoter"
/regulatory_class="promoter"
CDS 6547..7359
/label=KanR
/note="aminoglycoside phosphotransferase"
regulatory 7440..7489
/label=tD2 terminator
/note="tD2 terminator"
/regulatory_class="terminator"
This page is informational only.