Basic Vector Information
- Vector Name:
- FA(1)_YQR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3852 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Groseclose TM, Rondon RE, Herde ZD, Aldrete CA
FA(1)_YQR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
FA(1)_YQR vector Sequence
LOCUS 62056_736 3852 bp DNA circular SYN 10-SEP-2020 DEFINITION Cloning vector FA(1)_YQR, complete sequence. ACCESSION MT127350 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3852) AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ. TITLE Engineered systems of inducible anti-repressors for the next generation of biological programming JOURNAL Nat Commun 11 (1), 4440 (2020) PUBMED 32895374 REFERENCE 2 (bases 1 to 3852) AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 3852) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "4440" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-FEB-2020) Chemical " COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3852 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 596..673 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 674..1678 /codon_start=1 /transl_table=11 /product="FA(1)_YQR" /label=FA /protein_id="QLY89217.1" /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKSSRSIGLVIPDLENTSYSRFANYLERQARQRGYQLKIACSEDQPD NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGQNELLDF LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS" protein_bind 1808..1829 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2020..2564 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 3090..3192 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 3193..3849 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.