Basic Vector Information
- Vector Name:
- pNC-Green-SubC
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5506 bp
- Type:
- Plant binary expression vector
- Replication origin:
- pSa ori
- Host:
- Plants
- Source/Author:
- Yan P, Zeng Y, Shen W, Tuo D
- Promoter:
- CaMV35S(short)
pNC-Green-SubC vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNC-Green-SubC vector Sequence
LOCUS 62056_17810 5506 bp DNA circular SYN 04-SEP-2019 DEFINITION Plant binary expression vector pNC-Green-SubC, complete sequence. ACCESSION MK896905 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5506) AUTHORS Yan P, Zeng Y, Shen W, Tuo D, Li X, Zhou P. TITLE Direct Submission JOURNAL Submitted (07-MAY-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China REFERENCE 2 (bases 1 to 5506) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (07-MAY-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China" FEATURES Location/Qualifiers source 1..5506 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 184..529 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" promoter 725..827 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 858..1160 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS 1221..1937 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" terminator 1963..2215 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(2233..2249) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2286..2304) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2325..2341) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2349..2365) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2373..2404) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2419..2440) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 2679..2703 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(2794..3382) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3556..4368) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 4659..5094 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 5229..5251 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" primer_bind 5420..5436 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5443..5461 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 5487..5503 /label=KS primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.