FS_YQR_L95I vector (V015285)

MSDS

Basic Vector Information

Vector Name:: FS_YQR_L95I

Antibiotic Resistance:: Chloramphenicol

Length:: 3852 bp

Type:: Cloning vector

Replication origin:: p15A ori

Source/Author:: Groseclose TM, Rondon RE, Herde ZD, Aldrete CA

FS_YQR_L95I vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

FS_YQR_L95I vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_891        3852 bp DNA     circular SYN 10-SEP-2020
DEFINITION  Cloning vector FS_YQR_L95I, complete sequence.
ACCESSION   MT127342
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3852)
  AUTHORS   Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ.
  TITLE     Engineered systems of inducible anti-repressors for the next 
            generation of biological programming
  JOURNAL   Nat Commun 11 (1), 4440 (2020)
  PUBMED    32895374
REFERENCE   2  (bases 1 to 3852)
  AUTHORS   Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ.
  TITLE     Direct Submission
  JOURNAL   
REFERENCE   3  (bases 1 to 3852)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "4440"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-FEB-2020) Chemical "
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3852
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        596..673
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             674..1678
                     /codon_start=1
                     /transl_table=11
                     /product="FS_YQR L95I"
                     /label=FS_YQR L95I
                     /protein_id="QLY89201.1"
                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKSSRSIGLVIPDLENTSYTRIANYLERQARQRGYQLIIACSEDQPD
                     NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
                     QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
                     EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
                     LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
     protein_bind    1808..1829
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      2020..2564
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        3090..3192
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             3193..3849
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"

This page is informational only.