Basic Vector Information
- Vector Name:
- BFP-KDEL
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4718 bp
- Type:
- Subcellular localization
- Replication origin:
- ori
- Host:
- Mammalian cells
- Promoter:
- SV40
- 5' Primer:
- pEBFP-C1
- 3' Primer:
- CMV-F
- Growth Temperature:
- 37℃
BFP-KDEL vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
BFP-KDEL vector Sequence
LOCUS 62056_431 4718 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4718) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4718 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 25..328 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 329..532 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 615..1310 /codon_start=1 /label=TagBFP /note="monomeric blue fluorescent protein" /translation="SELIKENMHMKLYMEGTVDNHHFKCTSEGEGKPYEGTQTMRIKVV EGGPLPFAFDILATSFLYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTAT QDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKL VGGSHLIANIKTTYRSKKPAKNLKMPGVYYVDYRLERIKEANNETYVEQHEVAVARYCD LPSKLGHKLN" polyA_signal 1470..1591 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1598..2053) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2080..2184 /label=AmpR promoter promoter 2186..2543 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2578..3369 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3604..3651 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3980..4568 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 4683..4718 /label=CMV /note="Human cytomegalovirus immediate early enhancer/promoter"
This page is informational only.