Basic Vector Information
- Vector Name:
- pNeae2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5832 bp
- Type:
- Protein expression, Antibody expression
- Replication origin:
- ori
- Host:
- E. coli
- Promoter:
- Lac
- Growth Temperature:
- 37℃
pNeae2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNeae2 vector Sequence
LOCUS 62056_17865 5832 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5832) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..5832 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..31 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 39..55 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 63..79 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2131..2148 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" rep_origin 2283..2738 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS 2925..3581 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" rep_origin 3916..4504 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 4569..4646 /label=lacI promoter CDS 4647..5726 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 5797..5818 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP."
This page is informational only.