Basic Vector Information
- Vector Name:
- PDHB1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8979 bp
- Type:
- Hybridization
- Replication origin:
- ori
- Host:
- Yeast
- Selection Marker:
- LEU2
- Promoter:
- ADH1(long)
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
PDHB1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
PDHB1 vector Sequence
LOCUS 62056_8410 8979 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8979) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..8979 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 15..31 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 39..55 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 76..94 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter 863..1567 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1" CDS 2555..2788 /codon_start=1 /label=VP16 AD /note="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF TPHDSAPYGALDMADFEFEQMFTDALGIDEYGG" terminator 2793..3037 /label=CYC1 terminator /note="transcription terminator for CYC1" promoter complement(3060..3078) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3088..3104) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3249..3704 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4004..4408 /label=LEU2 promoter CDS 4421..5512 /codon_start=1 /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" /translation="MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHL IGGAAIDATGVPLPDEALEASKKVDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA NLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYT VPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQ LIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAF GLYEPCHGSAPDLPKNKVDPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG DLGGSNSTTEVGDAVAEEVKKILA" CDS complement(6236..7048) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 7490..8078 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8255..8756) /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" protein_bind 8920..8941 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 8956..8979 /label=lac promoter /note="promoter for the E. coli lac operon"
This page is informational only.