pUC57-pNZ8148-EGFP vector (Cat. No.: V014299)

pUC57-pNZ8148-EGFP6547 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300AmpR promoterAmpRoriCAP binding sitelac promoterlac operatorM13 revPnisAEGFPFactor Xa siterepCrepAcatM13 fwd
Basic Information
Name:
pUC57-pNZ8148-EGFP
Antibiotic Resistance:
Ampicillin
Length:
6547 bp
Type:
Protein expression
Replication origin:
ori
Host:
Lactic acid bacteria
Selection Marker:
Chl
Promoter:
PnisA
Growth Strain(s):
DH10B
Growth Temperature:
37℃
$ 199.3
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pUC57-pNZ8148-EGFP vector (Cat. No.: V014299) Sequence

LOCUS       Exported                6547 bp DNA     circular SYN 29-JUL-2025
DEFINITION  Exported.
ACCESSION   V014299
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6547)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6547)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 6547)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6547)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6547
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        96..200
                     /label=AmpR promoter
     CDS             201..1058
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      1232..1820
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    2108..2129
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2144..2174
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2182..2198
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2206..2222
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2245..2428
                     /label=PnisA
                     /note="Originated from Lactococcus lactis subsp. Lactis,
                     PnisA is a member of the two-component regulatory system 
                     NisK/NisR involved in the regulation of the biosynthesis of
                     lantibiotic nisin. PnisA functions as a promoter which is 
                     activated by phosphorylated NisR and enhance downstream 
                     gene expression in response to environmental nisin 
                     signals."
     CDS             2444..3160
                     /label=EGFP
                     /note="enhanced GFP"
     CDS             complement(3577..3588)
                     /label=Factor Xa site
                     /note="Factor Xa recognition and cleavage site"
     CDS             3722..3931
                     /codon_start=1
                     /label=repC
                     /note="repC"
                     /note="Replication gene C"
                     /translation="MGGKEANFASVLRPPIKCRVPIFVPKTLYPNWLKGLRGFSIANES
                     PTFSPTFFINLYLSSFIFVFMITK"
     CDS             4200..4898
                     /codon_start=1
                     /label=repA
                     /note="repA"
                     /note="Replication gene A"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     CDS             5358..6005
                     /gene="cat"
                     /label=Chloramphenicol acetyltransferase
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     primer_bind     complement(6153..6169)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"