pUC57-pNZ8148-EGFP vector (Cat. No.: V014299)
- Name:
- pUC57-pNZ8148-EGFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6547 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Lactic acid bacteria
- Selection Marker:
- Chl
- Promoter:
- PnisA
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pUC57-pNZ8148-EGFP vector (Cat. No.: V014299) Sequence
LOCUS Exported 6547 bp DNA circular SYN 29-JUL-2025
DEFINITION Exported.
ACCESSION V014299
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6547)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 6547)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 6547)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6547)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6547
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 96..200
/label=AmpR promoter
CDS 201..1058
/label=AmpR
/note="beta-lactamase"
rep_origin 1232..1820
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2108..2129
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2144..2174
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2182..2198
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2206..2222
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 2245..2428
/label=PnisA
/note="Originated from Lactococcus lactis subsp. Lactis,
PnisA is a member of the two-component regulatory system
NisK/NisR involved in the regulation of the biosynthesis of
lantibiotic nisin. PnisA functions as a promoter which is
activated by phosphorylated NisR and enhance downstream
gene expression in response to environmental nisin
signals."
CDS 2444..3160
/label=EGFP
/note="enhanced GFP"
CDS complement(3577..3588)
/label=Factor Xa site
/note="Factor Xa recognition and cleavage site"
CDS 3722..3931
/codon_start=1
/label=repC
/note="repC"
/note="Replication gene C"
/translation="MGGKEANFASVLRPPIKCRVPIFVPKTLYPNWLKGLRGFSIANES
PTFSPTFFINLYLSSFIFVFMITK"
CDS 4200..4898
/codon_start=1
/label=repA
/note="repA"
/note="Replication gene A"
/translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
KKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
VLDAETGEIK"
CDS 5358..6005
/gene="cat"
/label=Chloramphenicol acetyltransferase
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
primer_bind complement(6153..6169)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"