Basic Vector Information
- Vector Name:
- pLXRN-chTERT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6091 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells, Retrovirus
- Selection Marker:
- Neo/G418
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pLXRN-chTERT vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLXRN-chTERT vector Sequence
LOCUS 62056_16360 6091 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6091) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6091 /mol_type="other DNA" /organism="synthetic DNA construct" LTR 219..806 /label=5' LTR /note="long terminal repeat from Moloney murine sarcoma virus" misc_feature 869..1068 /label=MMLV Psi /note="packaging signal of Moloney murine leukemia virus (MMLV)" CDS 1269..1685 /codon_start=1 /label=gag (truncated) /note="truncated Moloney murine leukemia virus (MMLV) gag gene lacking the start codon" /translation="GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTF NVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKP PPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGA" misc_feature 1710..2294 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 2317..3117 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MGSAIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQ GRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQD LLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE EHQGLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ DIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" LTR 3180..3773 /label=LTR /note="long terminal repeat from Moloney murine leukemia virus" misc_feature 3984..4124 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4310..4898) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5072..5929) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(5930..6034) /label=AmpR promoter
This page is informational only.