pKITE301 vector (V005228)

LOCUS       40924_26784        3267 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pKITE301 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3267)
  AUTHORS   Toda, H., Itoh, N.
  TITLE     Development of novel E. coli-Kocuria shuttle vector using cryptic 
            plasmid pKPAL3 from Kocuria palustris IPUFS-1 and utilization for 
            producing enantiopure (S)-styrene oxide
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3267)
  AUTHORS   Itoh N, Toda, H.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-AUG-2017) Contact:Nobuya Itoh Toyama Prefectural 
            University, Biotechnology Research Center; 5180 Kurokawa, Imizu, 
            Toyama 939-0398, Japan URL :http://www.pu-toyama.ac.jp/BR/itoh/
REFERENCE   3  (bases 1 to 3267)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3267)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-AUG-2017) Contact:Nobuya Itoh Toyama Prefectural University, 
            Biotechnology Research Center"; volume: " 5180 Kurokawa, Imizu, 
            Toyama 939-0398, Japan URL :http"; pages: 
            "//www.pu-toyama.ac.jp/BR/itoh"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3267
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    39..60
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        75..105
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    113..129
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     137..153
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    162..218
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(222..238)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(460..1272)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSKPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      1654..2242
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      2264..3267
                     /label=pKPAL3-derived plasmid replication origin
                     /note="pKPAL3-derived plasmid replication origin"