pKITE101 vector (V005232)

LOCUS       40924_26764        3882 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pKITE101 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3882)
  AUTHORS   Toda H, Koyanagi T, Enomoto T, Itoh N.
  TITLE     Characterization of two cryptic plasmids from Kocuria palustris 
            IPUFS-1 and construction of novel Escherichia coli-Kocuria shuttle 
            vector for biocatalysis
  JOURNAL   J. Biosci. Bioeng. 124 (3), 255-262 (2017)
  PUBMED    28495560
REFERENCE   2  (bases 1 to 3882)
  AUTHORS   Itoh N, Toda H, Koyanagi T, Enomoto T.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2016) Contact:Nobuya Itoh Toyama Prefectural 
            University, Biotechnology Research Center; 5180 Kurokawa, Imizu, 
            Toyama 939-0398, Japan URL :http://www.pu-toyama.ac.jp/BR/itoh/
REFERENCE   3  (bases 1 to 3882)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3882)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Biosci. 
            Bioeng."; date: "2017"; volume: "124"; issue: "3"; pages: "255-262"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-DEC-2016) Contact:Nobuya Itoh Toyama Prefectural University, 
            Biotechnology Research Center"; volume: " 5180 Kurokawa, Imizu, 
            Toyama 939-0398, Japan URL :http"; pages: 
            "//www.pu-toyama.ac.jp/BR/itoh"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3882
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          2270..3876
                     /plasmid="pKPAL1"
                     /strain="IPUFS-1"
                     /mol_type="other DNA"
                     /db_xref="taxon:71999"
                     /organism="Kocuria palustris"
     protein_bind    39..60
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        75..105
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    113..129
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     137..153
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    162..218
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(222..238)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(460..1272)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      1654..2242
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             2402..3277
                     /codon_start=1
                     /gene="repA"
                     /product="replication protein"
                     /label=repA
                     /protein_id="BAX51295.1"
                     /translation="MTTAECVQRWDQMWLPLWPLASDDLHAGVYRQARGEAMHRRYIET
                     NPRALSNLLVVDIDHEDAALRTMWNRQAWWPNAVVENPSNGHAHAVWALNEPITRTEYA
                     RRKPLAFAAAVTEGLRRSVDGDTGYSGLLTKNPAHDDWDALWCNSDRLYDLDELAEHLT
                     EGGYMPPVSWKRSKRRNSVGLGRNCSIFETARTWAYREIRNHWFDSAGLHDAISAHVHE
                     LNAEFPEPLPASEARAIAASIHRWITTKSRMWADGPAVYEATFSTIQAARGRKRVERTK
                     ALLEGWQPNG"
     gene            2402..3277
                     /gene="repA"
                     /label=repA
     CDS             3270..3578
                     /codon_start=1
                     /gene="repB"
                     /product="replication protein"
                     /label=repB
                     /protein_id="BAX51296.1"
                     /translation="MGDRYDRKGSSISEMSRGTGLSPATIKRWTSRSRDEWLQQKADER
                     EAIRAFHDDEGHSWPQTAKHFRLDVSTVKRRAYRAREERKQEIAEQLQPPLPFPTNS"
     gene            3270..3578
                     /gene="repB"
                     /label=repB