pKanB vector (Cat. No.: V005255)
Basic Information
- Name:
- pKanB
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4250 bp
- Type:
- Intracelluar expression vector
- Replication origin:
- ori
- Source/Author:
- Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P, Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP.
- Promoter:
- AOX1
pKanB vector (Cat. No.: V005255) Sequence
LOCUS 40924_26536 4250 bp DNA circular SYN 18-DEC-2018
DEFINITION Intracelluar expression vector pKanB, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4250)
AUTHORS Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P,
Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP.
TITLE Direct selection of Pichia pastoris expression strains using new
G418 resistance vectors
JOURNAL Yeast 25 (4), 293-299 (2008)
PUBMED 18327886
REFERENCE 2 (bases 1 to 4250)
AUTHORS Lin-Cereghino J, Lin-Cereghino G.
TITLE Direct Submission
JOURNAL Submitted (16-NOV-2007) Biological Sciences, University of the
Pacific, 3601 Pacific Ave, Stockton, CA 95211, USA
REFERENCE 3 (bases 1 to 4250)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4250)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Yeast";
date: "2008"; volume: "25"; issue: "4"; pages: "293-299"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(16-NOV-2007) Biological Sciences, University of the Pacific, 3601
Pacific Ave, Stockton, CA 95211, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4250
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..922
/label=AOX1 promoter
/note="inducible promoter, regulated by methanol"
misc_feature 921..953
/label=multiple cloning site
/note="multiple cloning site"
CDS 971..1000
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 1016..1033
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 1113..1359
/label=AOX1 terminator
/note="transcription terminator for AOX1"
CDS 1918..2730
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
CDS 2752..2781
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 2797..2814
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 2893..3139
/gene="Pichia pastoris AOX1"
/label=AOX1 terminator
/note="transcription terminator for AOX1"
terminator 3260..3507
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(3582..4170)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.