pKanB alpha vector (Cat. No.: V005256)
Basic Information
- Name:
- pKanB alpha
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4558 bp
- Type:
- Extracellular expression vector
- Replication origin:
- ori
- Source/Author:
- Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P, Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP.
- Promoter:
- AOX1
pKanB alpha vector (Cat. No.: V005256) Sequence
LOCUS 40924_26531 4558 bp DNA circular SYN 18-DEC-2018
DEFINITION Extracellular expression vector pKanB alpha, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4558)
AUTHORS Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P,
Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP.
TITLE Direct selection of Pichia pastoris expression strains using new
G418 resistance vectors
JOURNAL Yeast 25 (4), 293-299 (2008)
PUBMED 18327886
REFERENCE 2 (bases 1 to 4558)
AUTHORS Lin-Cereghino G, Lin-Cereghino J.
TITLE Direct Submission
JOURNAL Submitted (17-NOV-2007) Biological Sciences, University of the
Pacific, 3601 Pacific Ave, Stockton, CA 95211, USA
REFERENCE 3 (bases 1 to 4558)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4558)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Yeast";
date: "2008"; volume: "25"; issue: "4"; pages: "293-299"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-NOV-2007) Biological Sciences, University of the Pacific, 3601
Pacific Ave, Stockton, CA 95211, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4558
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..940
/label=AOX1 promoter
/note="inducible promoter, regulated by methanol"
CDS 941..1207
/codon_start=1
/label=alpha-factor secretion signal
/note="N-terminal secretion signal from S. cerevisiae
alpha-factor"
/translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLE
GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA"
CDS 1279..1308
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 1324..1341
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 1421..1667
/label=AOX1 terminator
/note="transcription terminator for AOX1"
CDS 2226..3038
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
CDS 3060..3089
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 3105..3122
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 3201..3447
/gene="Pichia pastoris AOX1"
/label=AOX1 terminator
/note="transcription terminator for AOX1"
terminator 3568..3815
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(3890..4478)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.