pJG4-5 (pB42AD) vector (V005332)

LOCUS       40924_26091        6449 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pJG4-5 (pB42AD), complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6449)
  AUTHORS   Gyuris J, Golemis E, Chertkov H, Brent R.
  TITLE     Cdi1, a human G1 and S phase protein phosphatase that associates 
            with Cdk2
  JOURNAL   Cell 75 (4), 791-803 (1993)
  PUBMED    8242750
REFERENCE   2  (bases 1 to 6449)
  AUTHORS   Gyuris J, Golemis E, Chertkov H, Brent R.
  TITLE     pB42AD (pJG4-5) complete sequence
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 6449)
  AUTHORS   Golemis E, Gyuris J, Chertkov H, Brent R.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-1997) CLONTECH Laboratories, Inc., 1020 East 
            Meadow Circle, Palo Alto, CA 94303-4230, USA
REFERENCE   4  (bases 1 to 6449)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 6449)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Cell"; 
            date: "1993"; volume: "75"; issue: "4"; pages: "791-803"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (19-FEB-1997) CLONTECH Laboratories, Inc., 1020 East Meadow Circle, 
            Palo Alto, CA 94303-4230, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     This vector can be obtained from CLONTECH Laboratories, Inc., 1020 
            East Meadow Circle, Palo Alto, CA 94303-4230, USA. To place an order
            call (415) 424-8222 or (800) 662-2566, extension 1. International 
            customers, please contact your local distributor. For technical 
            information, call (415) 424-8222 or (800) 662-2566, extension 3. 
            This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH. If you suspect there is an 
            error in this sequence, please contact CLONTECH's Technical Support 
            Department at (415) 424-8222 or (800) 662-2566, extension 3 or 
            E-mail TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..6449
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        81..522
                     /label=GAL1 promoter
                     /note="inducible promoter, regulated by Gal4"
     CDS             546..566
                     /codon_start=1
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /translation="PKKKRKV"
     CDS             573..809
                     /codon_start=1
                     /label=B42 transcriptional activator
                     /note="yeast transcriptional activator cretaed from E. coli
                     genomic DNA fragments (Ma and Ptashne, 1987)"
                     /translation="INKDIEECNAIIEQFIDYLRTGQEMPMEMADQAINVVPGMTPKTI
                     LHAGPPIQPDWLKSNGFHEIEADVNDTSLLLSGD"
     CDS             816..842
                     /codon_start=1
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
                     /translation="YPYDVPDYA"
     terminator      1004..1191
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae
                     alcohol dehydrogenase 1 (ADH1) gene"
     rep_origin      1713..3055
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     CDS             complement(3419..4090)
                     /codon_start=1
                     /label=TRP1
                     /note="phosphoribosylanthranilate isomerase, required for 
                     tryptophan biosynthesis"
                     /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
                     RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
                     WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
                     VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
                     KK"
     promoter        complement(4091..4192)
                     /label=TRP1 promoter
     promoter        4295..4399
                     /label=AmpR promoter
     CDS             4400..5257
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      5431..6019
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    6307..6328
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        6343..6373
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6381..6397
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     6405..6421
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"