pJFR3 vector (V005347)

LOCUS       V005347                 9512 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005347
VERSION     V005347
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9512)
  AUTHORS   Fernandez-Rodriguez J, Moser F, Voigt CA.
  TITLE     Multichromatic Bacterial Photography
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9512)
  AUTHORS   Fernandez-Rodriguez J, Moser F, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2016) Biological Engineering, MIT, 500 Tech
            Square, Rm 140, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 9512)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9512)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (31-MAR-2016) Biological Engineering, MIT, 500 Tech Square, Rm 140,
            Cambridge, MA 02139, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9512
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    231..278
                     /label="Terminator L3S1P22"
                     /note="Terminator L3S1P22"
     CDS             complement(285..1031)
                     /codon_start=1
                     /product="pcyA"
                     /label="pcyA"
                     /protein_id="ARG47676.1"
                     /translation="MAVTDLSLTNSSLMPTLNPMIQQLALAIAASWQSLPLKPYQLPED
                     LGYVEGRLEGEKLVIENRCYQTPQFRKMHLELAKVGKWLDILHCVMFPEPLYGLPLFGC
                     DIVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQPEFEQQRELPPWGEIFSEYCL
                     FIRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEAQTLEHRQGQIHYCQQQQKNDKT
                     RRVLEKAFGEAWAERYMSQVLFDVIQ"
     RBS             1038..1049
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             complement(1055..1774)
                     /gene="pbsA1"
                     /label="Heme oxygenase 1"
                     /note="Heme oxygenase 1 from Synechocystis sp. (strain PCC
                     6803 / Kazusa). Accession#: P72849"
     RBS             1781..1792
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     regulatory      complement(1809..1843)
                     /label="Promoter J23108"
                     /note="Promoter J23108"
                     /regulatory_class="promoter"
     promoter        complement(1809..1842)
                     /label="J23119 promoter"
                     /note="bacterial promoter (Registry of Standard Biological
                     Parts BBa_J23119)"
     regulatory      1894..3050
                     /label="Promoter PompC1157"
                     /note="Promoter PompC1157"
                     /regulatory_class="promoter"
     CDS             3083..3793
                     /label="lambda repressor"
                     /note="phage lambda repressor"
     CDS             3794..3826
                     /label="ssrA tag (LVA)"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     misc_feature    3863..4026
                     /label="Terminator DT11"
                     /note="Terminator DT11"
     misc_feature    4065..4086
                     /label="BioBrick prefix"
                     /note="BioBrick prefix for parts that do not start with
                     'ATG'"
     regulatory      4087..4168
                     /label="Promoter Bba_J64067"
                     /note="Promoter Bba_J64067"
                     /regulatory_class="promoter"
     misc_feature    4208..4333
                     /label="similar to SynZip 18"
                     /note="similar to SynZip 18"
     misc_feature    4334..4348
                     /label="similar to GGSGG linker"
                     /note="similar to GGSGG linker"
     misc_feature    4349..5203
                     /label="similar to K1F Fragment of T7 RNAP"
                     /note="similar to K1F Fragment of T7 RNAP"
     misc_feature    5213..5259
                     /label="Terminator L3S3P11"
                     /note="Terminator L3S3P11"
     terminator      5378..5407
                     /label="T3Te terminator"
                     /note="phage T3 early transcription terminator"
     terminator      complement(5467..5526)
                     /label="his operon terminator"
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during
                     synthesis. Its efficiency has not been determined."
     misc_feature    5548..5578
                     /label="Terminator tR2"
                     /note="Terminator tR2"
     CDS             complement(5595..5828)
                     /label="TpR"
                     /note="E. coli plasmid-associated dihydrofolate reductase"
     promoter        complement(5856..5890)
                     /label="J23119 promoter"
                     /note="bacterial promoter (Registry of Standard Biological
                     Parts BBa_J23119)"
     misc_feature    complement(6024..6548)
                     /label="nuc1"
                     /note="nuc1"
     misc_feature    complement(6545..7174)
                     /label="kfrA"
                     /note="kfrA"
     rep_origin      complement(7420..7855)
                     /direction=LEFT
                     /label="pSa ori"
                     /note="origin of replication from bacterial plasmid pSa"
     CDS             complement(7895..8863)
                     /label="RepA"
                     /note="replication protein of plasmid pSa"
     misc_feature    complement(8856..9512)
                     /label="resP"
                     /note="resP"