pIMAY vector (Cat. No.: V005433)

pIMAY5743 bp60012001800240030003600420048005400Factor Xa siterepBrepCrepA(ts)catregulatoryT3 promoterMCST7 promoterp15A orioriTantisense_RNAtet operatortet operatorTetR
Basic Information

Note: The pIMAY is a E. coli/staphylococcal temperature-sensitive plasmid for allelic exchange. E.coli bearing pIMAY MUST be cultured at 37℃ in Chloramphenicol (10µg/ml).

Name:
pIMAY
Antibiotic Resistance:
Chloramphenicol
Length:
5743 bp
Type:
Staphylococcal allelic exchange vector
Replication origin:
p15A ori
Source/Author:
Monk IR, Shah IM, Xu M, Tan MW, Foster TJ.
Copy Number:
Low copy number
Promoter:
T3
Growth Strain(s):
DH10B
Growth Temperature:
37℃
$ 199.3
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Monk IR, Shah IM, Xu M, Tan MW, Foster TJ. Transforming the untransformable: application of direct transformation to manipulate genetically Staphylococcus aureus and Staphylococcus epidermidis. mBio. 2012;3(2):e00277-11. Published 2012 Mar 20. doi:10.1128/mBio.00277-11

pIMAY vector (Cat. No.: V005433) Sequence

LOCUS       V005433                 5743 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005433
VERSION     V005433
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5743)
  AUTHORS   Monk IR, Shah IM, Xu M, Tan MW, Foster TJ.
  TITLE     Transforming the Untransformable: Application of Direct
            Transformation To Manipulate Genetically Staphylococcus aureus and
            Staphylococcus epidermidis
  JOURNAL   MBio 3 (2), e00277-11 (2012)
   PUBMED   22434850
REFERENCE   2  (bases 1 to 5743)
  AUTHORS   Monk IR.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2012) Department of Microbiology, Trinity College
            Dublin, Nassau St, Dublin, Dublin 2, Ireland
REFERENCE   3  (bases 1 to 5743)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5743)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "MBio";
            date: "2012"; volume: "3"; issue: "2"; pages: "e00277-11"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (03-FEB-2012) Department of Microbiology, Trinity College Dublin,
            Nassau St, Dublin, Dublin 2, Ireland"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5743
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(157..168)
                     /label="Factor Xa site"
                     /note="Factor Xa recognition and cleavage site"
     CDS             302..511
                     /codon_start=1
                     /gene="repB"
                     /product="RepB"
                     /label="repB"
                     /protein_id="AFG28167.1"
                     /translation="MGGKEANFASVLRPPIKCRVPIFVPKTLYPNWLKGLRGFSIANES
                     PTFSPTFFINLYLSSFIVVFMITK"
     gene            302..511
                     /gene="repB"
                     /label="repB"
                     /note="derived from pVE6007"
     CDS             552..713
                     /codon_start=1
                     /gene="repC"
                     /product="RepC"
                     /label="repC"
                     /protein_id="AFG28168.1"
                     /translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA
                     RKESEQKK"
     gene            552..713
                     /gene="repC"
                     /label="repC"
                     /note="derived from pVE6007"
     CDS             780..1478
                     /codon_start=1
                     /gene="repA(ts)"
                     /product="RepA(ts)"
                     /label="repA(ts)"
                     /protein_id="AFG28172.1"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     gene            780..1478
                     /gene="repA(ts)"
                     /label="repA(ts)"
                     /note="derived from pVE6007"
     CDS             1475..1624
                     /codon_start=1
                     /gene="repD"
                     /product="RepD"
                     /label="repD"
                     /protein_id="AFG28169.1"
                     /translation="MTNKEKELFAENEELKKEIKDLKERIERYREMEVELSTTIDLLRG
                     GIIE"
     gene            1475..1624
                     /gene="repD"
                     /label="repD"
                     /note="derived from pVE6007"
     CDS             complement(1827..2474)
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     regulatory      complement(2475..2674)
                     /regulatory_class="promoter"
     promoter        2675..2693
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    complement(2706..2813)
                     /label="MCS"
                     /note="pBluescript multiple cloning site"
     promoter        complement(2822..2840)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     rep_origin      complement(3347..3892)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     oriT            complement(4034..4143)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"
     ncRNA           4373..4933
                     /product="secY"
                     /label="antisense_RNA"
                     /note="derived from pKOR1"
                     /ncRNA_class="antisense_RNA"
     protein_bind    4957..4975
                     /label="tet operator"
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O1 for the tetR and tetA genes"
     protein_bind    complement(5042..5060)
                     /label="tet operator"
                     /note="bacterial operator O1 for the tetR and tetA genes"
     CDS             5082..5705
                     /label="TetR"
                     /note="tetracycline repressor TetR"