pHR-Ech_0230-tuf-aadA vector (V005513)

LOCUS       40924_24867        7173 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pHR-Ech_0230-tuf-aadA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7173)
  AUTHORS   Wang Y, Wei L, Liu H, Cheng C, Ganta RR.
  TITLE     A genetic system for targeted mutations to disrupt and restore genes
            in the obligate bacterium, Ehrlichia chaffeensis
  JOURNAL   Sci Rep 1, 15801 (2017)
  PUBMED    29150636
REFERENCE   2  (bases 1 to 7173)
  AUTHORS   Ganta RR.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAY-2017) Department of Diagnostic 
            Medicine/Pathobiology, College of Veterinary Medicine, Kansas State 
            University, 1800 Denison Ave, Manhattan, KS 66503, USA
REFERENCE   3  (bases 1 to 7173)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7173)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep 1, 
            15801 (2017)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-MAY-2017) Department of Diagnostic Medicine/Pathobiology, 
            College of Veterinary Medicine, Kansas State University, 1800 
            Denison Ave, Manhattan, KS 66503, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7173
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    107..128
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        143..173
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    181..197
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     205..221
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    295..1333
                     /label=Ehrlichia chaffeensis str. Arkansas genomic region
                     /note="Ehrlichia chaffeensis str. Arkansas genomic region"
     regulatory      1334..1706
                     /gene="tuf-2"
                     /regulatory_class="promoter"
     gene            1334..1706
                     /gene="tuf-2"
                     /label=tuf-2
     CDS             1707..2495
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside-3'-adenylyltransferase"
                     /label=aadA
                     /protein_id="ATY38622.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            1707..2495
                     /gene="aadA"
                     /label=aadA
     misc_feature    2502..3536
                     /label=Ehrlichia chaffeensis str. Arkansas genomic region
                     /note="Ehrlichia chaffeensis str. Arkansas genomic region"
     promoter        complement(3607..3625)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3632..3648)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      3789..4217
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     CDS             4561..5352
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             5373..6230
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      6404..6992
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"