pHIS-parallel1 vector (Cat. No.: V005547)
Note: The pHis-parallel1 plasmid is a bacterial expression vector featuring dual 6xHis tags at both ends of the open reading frame, enabling efficient protein purification via nickel-affinity chromatography.
- Name:
- pHIS-parallel1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5545 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Sheffield P, Garrard S, Derewenda Z.
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Mengkui Cui et al. ,Exploiting mammalian low-complexity domains for liquid-liquid phase separation–driven underwater adhesive coatings.Sci. Adv.5,eaax3155(2019).DOI:10.1126/sciadv.aax3155
pHIS-parallel1 vector (Cat. No.: V005547) Sequence
LOCUS Exported 5545 bp DNA circular SYN 19-JUL-2025
DEFINITION Expression vector pHIS-parallel1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5545)
AUTHORS Sheffield P, Garrard S, Derewenda Z.
TITLE Overcoming expression and purification problems of RhoGDI using a
family of 'parallel' expression vectors
JOURNAL Protein Expr. Purif. 15 (1), 34-39 (1999)
PUBMED 10024467
REFERENCE 2 (bases 1 to 5545)
AUTHORS Sheffield PJ, Garrard SM, Derewenda ZS.
TITLE Direct Submission
JOURNAL Submitted (07-OCT-1998) Molecular Physiology and Biological Physics,
University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park
Avenue, Charlottesville, VA 22908, USA
REFERENCE 3 (bases 1 to 5545)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5545)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 5545)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Protein
Expr. Purif."; date: "1999"; volume: "15"; issue: "1"; pages:
"34-39"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(07-OCT-1998) Molecular Physiology and Biological Physics,
University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park
Avenue, Charlottesville, VA 22908, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5545
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 12..467
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 493..597
/label=AmpR promoter
CDS 598..1455
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
rep_origin 1629..2217
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(2403..2542)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(2647..2835)
/codon_start=1
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
protein_bind complement(3610..3631)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
CDS complement(3647..4726)
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
promoter complement(4727..4804)
/label=lacI promoter
promoter 5113..5131
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind 5132..5156
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 5171..5193
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 5213..5230
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
CDS 5252..5272
/codon_start=1
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
/translation="ENLYFQG"
CDS 5389..5406
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 5473..5520
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"