Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V011877 | Clover-Geminin(1-110) | In stock, 1 week for quality controls |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- Clover-Geminin(1-110)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7475 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- U6
- 5' Primer:
- agctggtttagtgaaccgtcagatc
- 3' Primer:
- ggaaccggaacccttaaaca
Clover-Geminin(1-110) vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Clover-Geminin(1-110) vector Sequence
LOCUS V011877 7475 bp DNA circular SYN 13-MAY-2021
DEFINITION Exported.
ACCESSION V011877
VERSION V011877
KEYWORDS Clover-Geminin(1-110)
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 7475)
AUTHORS Bajar BT, Lam AJ, Badiee RK, Oh YH, Chu J, Zhou XX, Kim N, Kim BB,
Chung M, Yablonovitch AL, Cruz BF, Kulalert K, Tao JJ, Meyer T, Su
XD, Lin MZ
TITLE Fluorescent indicators for simultaneous reporting of all four cell
cycle phases.
JOURNAL Nat Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045.
PUBMED 27798610
REFERENCE 2 (bases 1 to 7475)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 7475)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Methods. 2016 Oct 31. doi: 10.1038/nmeth.4045."
SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7475
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 63..366
/label="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 368..566
/label="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
LTR 584..764
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
misc_feature 811..936
/label="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1435..1668
/label="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 1853..1897
/label="gp41 peptide"
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 2046..2087
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
/label="Protein Tat"
misc_feature 2195..2312
/label="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1"
promoter 2371..2684
/label="U6 promoter"
/note="RNA polymerase III promoter for mouse U6 snRNA (Das
et al., 1988)"
primer_bind 2701..2717
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 2759..2792
/label="loxP"
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
enhancer 2908..3211
/label="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 3212..3415
/label="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 3447..4163
/label="Clover"
/note="bright green-yellow fluorescent protein derived from
GFP (Lam et al., 2012)"
CDS 4194..4523
/codon_start=1
/product="degron consisting of residues 1-110 of human
Geminin (Zielke and Edgar, 2015)"
/label="Gem1 (1-110)"
/translation="MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELS
AGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAE
KRRKAL"
protein_bind complement(4562..4595)
/label="loxP"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
misc_feature 4651..5239
/label="WPRE"
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
primer_bind complement(5242..5258)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
LTR 5481..5661
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
rep_origin complement(5723..6311)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(6485..7342)
/label="AmpR"
/note="beta-lactamase"
promoter complement(7343..7447)
/label="AmpR promoter"