Basic Vector Information
- Vector Name:
- pMpGE_En03
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3214 bp
- Type:
- Gateway entry vector
- Replication origin:
- ori
- Source/Author:
- Sugano SS, Nishihama R, Shirakawa M, Matsuda Y, Takagi T, Hara-Nishimura I, Osakabe K, Kohchi T.
pMpGE_En03 vector Map
pMpGE_En03 vector Sequence
LOCUS 40924_31275 3214 bp DNA circular SYN 18-DEC-2018
DEFINITION Gateway entry vector pMpGE_En03 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3214)
AUTHORS Sugano SS, Nishihama R, Shirakawa M, Matsuda Y, Takagi T,
Hara-Nishimura I, Osakabe K, Kohchi T.
TITLE Efficient CRISPR/Cas9 vectors in Marchantia polymorpha
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3214)
AUTHORS Sugano SS, Kohchi T, Nishihama R.
TITLE Direct Submission
JOURNAL Submitted (14-OCT-2015) Contact:Shigeo S Sugano Tokushima
University, Center for Collaboration among Agriculture, Industry,
and Commerse; Kuramoto cho 3-18-15, Tokushima, Tokushima 770-8503,
Japan URL :http://www.tokushima-u.ac.jp/ccaic/
REFERENCE 3 (bases 1 to 3214)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3214)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(14-OCT-2015) Contact:Shigeo S Sugano Tokushima University, Center
for Collaboration among Agriculture, Industry, and Commerse";
volume: " Kuramoto cho 3-18-15, Tokushima, Tokushima 770-8503, Japan
URL :http"; pages: "//www.tokushima-u.ac.jp/ccaic"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3214
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(268..295)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(387..473)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 537..553
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 569..668
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
misc_feature 685..1199
/label=MpU6-1 promoter (500 bp)
/note="MpU6-1 promoter (500 bp)"
misc_feature 1200
/label=initial G
/note="initial G"
misc_feature complement(1202..1207)
/label=BsaI
/note="BsaI"
misc_feature 1215..1220
/label=BsaI
/note="BsaI"
misc_RNA 1222..1297
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
protein_bind complement(1339..1438)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(1456..1474)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(1479..1495)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1608..2414
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 2564..3152
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.