pMON93914 vector (V004679)

LOCUS       V004679                11397 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004679
VERSION     V004679
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 11397)
  AUTHORS   Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil
            VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R,
            Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
  TITLE     Expression of the Arabidopsis thaliana BBX32 Gene in Soybean
            Increases Grain Yield
  JOURNAL   PLoS ONE 7 (2), E30717 (2012)
   PUBMED   22363475
REFERENCE   2  (bases 1 to 11397)
  AUTHORS   Preuss SB.
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 11397)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11397)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2012"; volume: "7"; issue: "2"; pages: "E30717"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (27-JUL-2011) Yield "
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11397
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        295..639
                     /label="CaMV 35S promoter"
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_feature    680..1164
                     /label="derived from G. max BBX52 suppression element"
                     /note="derived from G. max BBX52 suppression element"
     3'UTR           1203..1638
                     /label="derived from G. barbadense E6"
                     /note="derived from G. barbadense E6"
     misc_feature    complement(1937..1961)
                     /label="LB T-DNA repeat"
                     /note="left border repeat from octopine Ach5 T-DNA"
     CDS             3337..3525
                     /label="rop"
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     misc_feature    3630..3770
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(3956..4544)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    5075..5963
                     /label="derived from E. coli aadA"
                     /note="derived from E. coli aadA"
     CDS             5117..5905
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy,
                     1985)"
                     /label="SmR"
                     /note="confers resistance to spectinomycin and
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     misc_feature    6214..6238
                     /label="LB T-DNA repeat"
                     /note="left border repeat from octopine Ach5 T-DNA"
     terminator      complement(6485..7126)
                     /label="E9 terminator"
                     /note="terminator and polyadenylation signal from the pea
                     rbcS-E9 gene"
     CDS             complement(7136..8500)
                     /gene="aroA"
                     /label="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase from
                     Agrobacterium sp. (strain CP4). Accession#: Q9R4E4"
     CDS             complement(8501..8728)
                     /codon_start=1
                     /product="EPSPS CTP"
                     /label="EPSPS CTP"
                     /note="derived from A. thaliana ShkG"
                     /protein_id="AEP17827.1"
                     /translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI
                     SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC"
     5'UTR           complement(8738..9405)
                     /label="derived from A. thaliana Tsf1"
                     /note="derived from A. thaliana Tsf1"
     regulatory      complement(9406..9885)
                     /label="derived from A. thaliana Tsf1"
                     /note="derived from A. thaliana Tsf1"
                     /regulatory_class="promoter"
     regulatory      complement(9909..10445)
                     /label="FMV 35S"
                     /note="FMV 35S"
                     /regulatory_class="enhancer"
     misc_feature    10508..10532
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     misc_feature    complement(11288..11312)
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"