Basic Vector Information
- Vector Name:
- pMON93914
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11397 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON93914 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMON93914 vector Sequence
LOCUS 40924_31225 11397 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMON93914, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11397)
AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil
VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R,
Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean
Increases Grain Yield
JOURNAL PLoS ONE 7 (2), E30717 (2012)
PUBMED 22363475
REFERENCE 2 (bases 1 to 11397)
AUTHORS Preuss SB.
TITLE Direct Submission
JOURNAL
REFERENCE 3 (bases 1 to 11397)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 11397)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2012"; volume: "7"; issue: "2"; pages: "E30717"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-JUL-2011) Yield "
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..11397
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 295..639
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
misc_feature 680..1164
/label=derived from G. max BBX52 suppression element
/note="derived from G. max BBX52 suppression element"
3'UTR 1203..1638
/label=derived from G. barbadense E6
/note="derived from G. barbadense E6"
misc_feature complement(1937..1961)
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
CDS 3337..3525
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
misc_feature 3630..3770
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(3956..4544)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 5075..5963
/label=derived from E. coli aadA
/note="derived from E. coli aadA"
CDS 5117..5905
/codon_start=1
/gene="aadA"
/product="aminoglycoside adenylyltransferase (Murphy,
1985)"
/label=SmR
/note="confers resistance to spectinomycin and
streptomycin"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
misc_feature 6214..6238
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
terminator complement(6485..7126)
/label=E9 terminator
/note="terminator and polyadenylation signal from the pea
rbcS-E9 gene"
CDS complement(7136..8500)
/gene="aroA"
/label=aroA
/note="3-phosphoshikimate 1-carboxyvinyltransferase from
Agrobacterium sp. (strain CP4). Accession#: Q9R4E4"
CDS complement(8501..8728)
/codon_start=1
/product="EPSPS CTP"
/label=EPSPS CTP
/note="derived from A. thaliana ShkG"
/protein_id="AEP17827.1"
/translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI
SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC"
5'UTR complement(8738..9405)
/label=derived from A. thaliana Tsf1
/note="derived from A. thaliana Tsf1"
regulatory complement(9406..9885)
/label=derived from A. thaliana Tsf1
/note="derived from A. thaliana Tsf1"
/regulatory_class="promoter"
regulatory complement(9909..10445)
/label=FMV 35S
/note="FMV 35S"
/regulatory_class="enhancer"
misc_feature 10508..10532
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
misc_feature complement(11288..11312)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
This page is informational only.