Basic Vector Information
- Vector Name:
- pMMS
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8367 bp
- Type:
- Expression vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P.
pMMS vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMMS vector Sequence
LOCUS 40924_31155 8367 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMMS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8367) AUTHORS Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P. TITLE Novel organic solvent-responsive expression vectors for biocatalysis: application for development of an organic solvent-tolerant biodesulfurizing strain JOURNAL Bioresour. Technol. 102 (20), 9380-9387 (2011) PUBMED 21875790 REFERENCE 2 (bases 1 to 8367) AUTHORS Tao F. TITLE Direct Submission JOURNAL Submitted (31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240, China REFERENCE 3 (bases 1 to 8367) TITLE Direct Submission REFERENCE 4 (bases 1 to 8367) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Bioresour. Technol."; date: "2011"; volume: "102"; issue: "20"; pages: "9380-9387" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8367 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 236..322 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 414..441 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 460..551 /label=AmpR promoter CDS 552..1409 /label=AmpR /note="beta-lactamase" rep_origin complement(1849..2243) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" CDS complement(2270..2554) /codon_start=1 /gene="mobC" /product="MobC" /label=mobC /note="mobilization protein C" /protein_id="AEM76688.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" gene complement(2270..2554) /gene="mobC" /label=mobC oriT 2585..2672 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 3501..3914 /codon_start=1 /gene="mobB" /product="MobB" /label=mobB /note="mobilization protein B" /protein_id="AEM76690.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" gene 3501..3914 /gene="mobB" /label=mobB CDS 3911..4879 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 5393..6229 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 6219..7067 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory 8274..8313 /gene="Psrp" /label=organic solvent responsive promoter /note="organic solvent responsive promoter" /regulatory_class="promoter" gene 8274..8313 /gene="Psrp" /label=Psrp
This page is informational only.