Basic Vector Information
- Vector Name:
- pMMS
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8367 bp
- Type:
- Expression vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P.
pMMS vector Map
pMMS vector Sequence
LOCUS 40924_31155 8367 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMMS, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8367)
AUTHORS Tao F, Liu Y, Luo Q, Su F, Xu Y, Li F, Yu B, Ma C, Xu P.
TITLE Novel organic solvent-responsive expression vectors for
biocatalysis: application for development of an organic
solvent-tolerant biodesulfurizing strain
JOURNAL Bioresour. Technol. 102 (20), 9380-9387 (2011)
PUBMED 21875790
REFERENCE 2 (bases 1 to 8367)
AUTHORS Tao F.
TITLE Direct Submission
JOURNAL Submitted (31-AUG-2010) School of Life Sciences and Biotechnology,
Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai,
Shanghai 200240, China
REFERENCE 3 (bases 1 to 8367)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8367)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Bioresour.
Technol."; date: "2011"; volume: "102"; issue: "20"; pages:
"9380-9387"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(31-AUG-2010) School of Life Sciences and Biotechnology, Shanghai
Jiao Tong University, 800 Dongchuan Road, Shanghai, Shanghai 200240,
China"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8367
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 236..322
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 414..441
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 460..551
/label=AmpR promoter
CDS 552..1409
/label=AmpR
/note="beta-lactamase"
rep_origin complement(1849..2243)
/direction=LEFT
/label=RSF1010 oriV
/note="replication origin of the broad-host-range plasmid
RSF1010; requires the RSF1010 RepA/B/C proteins for
replication (Scholz et al., 1989)"
CDS complement(2270..2554)
/codon_start=1
/gene="mobC"
/product="MobC"
/label=mobC
/note="mobilization protein C"
/protein_id="AEM76688.1"
/translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK
VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
gene complement(2270..2554)
/gene="mobC"
/label=mobC
oriT 2585..2672
/label=RSF1010 oriT
/note="origin of transfer of the broad-host-range plasmid
RSF1010 (Scholz et al., 1989)"
CDS 3501..3914
/codon_start=1
/gene="mobB"
/product="MobB"
/label=mobB
/note="mobilization protein B"
/protein_id="AEM76690.1"
/translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS
EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
gene 3501..3914
/gene="mobB"
/label=mobB
CDS 3911..4879
/label=RSF1010 RepB
/note="replication protein B of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 5393..6229
/label=RSF1010 RepA
/note="replication protein A of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 6219..7067
/label=RSF1010 RepC
/note="replication protein C of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
regulatory 8274..8313
/gene="Psrp"
/label=organic solvent responsive promoter
/note="organic solvent responsive promoter"
/regulatory_class="promoter"
gene 8274..8313
/gene="Psrp"
/label=Psrp
This page is informational only.