Basic Vector Information
- Vector Name:
- pMMPc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8306 bp
- Type:
- Expression vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Xu Y, Tao F, Ma C, Xu P.
pMMPc vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMMPc vector Sequence
LOCUS 40924_31145 8306 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMMPc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8306) AUTHORS Xu Y, Tao F, Ma C, Xu P. TITLE New constitutive vectors: useful genetic engineering tools for biocatalysis JOURNAL Appl. Environ. Microbiol. 79 (8), 2836-2840 (2013) PUBMED 23416993 REFERENCE 2 (bases 1 to 8306) AUTHORS Xu Y. TITLE Direct Submission JOURNAL Submitted (29-JAN-2013) State Key Laboratory of Microbial Technology, Shandong University, South Shanda Road, Jinan, Shandong 250100, China REFERENCE 3 (bases 1 to 8306) TITLE Direct Submission REFERENCE 4 (bases 1 to 8306) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2013"; volume: "79"; issue: "8"; pages: "2836-2840" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-JAN-2013) State Key Laboratory of Microbial Technology, Shandong University, South Shanda Road, Jinan, Shandong 250100, China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 7.0 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8306 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 236..322 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 414..441 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 460..551 /label=AmpR promoter CDS 552..1409 /label=AmpR /note="beta-lactamase" rep_origin complement(1849..2243) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" CDS complement(2270..2554) /codon_start=1 /gene="mobC" /product="mobilization protein C" /label=mobC /protein_id="AGG35800.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" gene complement(2270..2554) /gene="mobC" /label=mobC oriT 2585..2672 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 3501..3914 /codon_start=1 /gene="mobB" /product="mobilization protein B" /label=mobB /protein_id="AGG35802.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" gene 3501..3914 /gene="mobB" /label=mobB CDS 3911..4879 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 5393..6229 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 6219..7067 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory 8079..8303 /gene="Pc" /label=constitutive promoter /note="constitutive promoter" /regulatory_class="promoter" gene 8079..8303 /gene="Pc" /label=Pc
This page is informational only.