pMMPc vector (V004695)

LOCUS       40924_31145        8306 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pMMPc, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8306)
  AUTHORS   Xu Y, Tao F, Ma C, Xu P.
  TITLE     New constitutive vectors: useful genetic engineering tools for 
            biocatalysis
  JOURNAL   Appl. Environ. Microbiol. 79 (8), 2836-2840 (2013)
  PUBMED    23416993
REFERENCE   2  (bases 1 to 8306)
  AUTHORS   Xu Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JAN-2013) State Key Laboratory of Microbial 
            Technology, Shandong University, South Shanda Road, Jinan, Shandong 
            250100, China
REFERENCE   3  (bases 1 to 8306)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8306)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2013"; volume: "79"; issue: "8"; pages:
            "2836-2840"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (29-JAN-2013) State Key Laboratory of Microbial Technology, Shandong
            University, South Shanda Road, Jinan, Shandong 250100, China"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 7.0
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8306
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      236..322
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      414..441
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        460..551
                     /label=AmpR promoter
     CDS             552..1409
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      complement(1849..2243)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     CDS             complement(2270..2554)
                     /codon_start=1
                     /gene="mobC"
                     /product="mobilization protein C"
                     /label=mobC
                     /protein_id="AGG35800.1"
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK
                     VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     gene            complement(2270..2554)
                     /gene="mobC"
                     /label=mobC
     oriT            2585..2672
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             3501..3914
                     /codon_start=1
                     /gene="mobB"
                     /product="mobilization protein B"
                     /label=mobB
                     /protein_id="AGG35802.1"
                     /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS
                     EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
                     MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
     gene            3501..3914
                     /gene="mobB"
                     /label=mobB
     CDS             3911..4879
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             5393..6229
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             6219..7067
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      8079..8303
                     /gene="Pc"
                     /label=constitutive promoter
                     /note="constitutive promoter"
                     /regulatory_class="promoter"
     gene            8079..8303
                     /gene="Pc"
                     /label=Pc