Basic Vector Information
- Vector Name:
- pMLBAD
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 6775 bp
- Type:
- Broad host range vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Lefebre MD, Valvano MA.
- Promoter:
- araBAD
pMLBAD vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMLBAD vector Sequence
LOCUS 40924_31090 6775 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector pMLBAD, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6775) AUTHORS Lefebre MD, Valvano MA. TITLE Construction and evaluation of plasmid vectors optimized for constitutive and regulated gene expression in Burkholderia cepacia complex isolates JOURNAL Appl. Environ. Microbiol. 68 (12), 5956-5964 (2002) PUBMED 12450816 REFERENCE 2 (bases 1 to 6775) AUTHORS Lefebre MD, Valvano MA. TITLE Direct Submission JOURNAL Submitted (15-MAY-2002) Microbiology and Immunology, University of Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1, Canada REFERENCE 3 (bases 1 to 6775) TITLE Direct Submission REFERENCE 4 (bases 1 to 6775) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2002"; volume: "68"; issue: "12"; pages: "5956-5964" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAY-2002) Microbiology and Immunology, University of Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6775 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 55..83 /label=Pc promoter /note="class 1 integron promoter" CDS 410..643 /label=TpR /note="E. coli plasmid-associated dihydrofolate reductase" CDS complement(872..1747) /label=araC /note="L-arabinose regulatory protein" promoter 1774..2058 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" misc_feature 2084..2139 /note="multiple cloning site; EcoRI to HindIII" terminator 2342..2428 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2520..2547 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter complement(3402..3504) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS complement(3654..4673) /codon_start=1 /gene="mob" /product="Mob" /function="required for plasmid mobilization" /label=mob /protein_id="AAM63383.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS" gene complement(3654..4673) /gene="mob" /label=mob rep_origin 4897..5666 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 5667..6326 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica"
This page is informational only.