Basic Vector Information
- Vector Name:
- pMKEx2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8061 bp
- Type:
- Shuttle-expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Kortmann M, Kuhl V, Klaffl S, Bott M.
pMKEx2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMKEx2 vector Sequence
LOCUS 40924_31045 8061 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle-expression vector pMKEx2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8061) AUTHORS Kortmann M, Kuhl V, Klaffl S, Bott M. TITLE A chromosomally encoded T7 RNA polymerase-dependent gene expression system for Corynebacterium glutamicum: construction and comparative evaluation at the single-cell level JOURNAL Microb Biotechnol (2014) In press PUBMED 25488698 REFERENCE 2 (bases 1 to 8061) AUTHORS Kortmann M, Kuhl V, Klaffl S, Bott M. TITLE Direct Submission JOURNAL Submitted (25-SEP-2014) IBG-1: Biotechnology, Forschungszentrum Juelich GmbH, Wilhelm-Johnen-Strasse, Juelich 52425, Germany REFERENCE 3 (bases 1 to 8061) TITLE Direct Submission REFERENCE 4 (bases 1 to 8061) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microb Biotechnol (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-SEP-2014) IBG-1: Biotechnology, Forschungszentrum Juelich GmbH, Wilhelm-Johnen-Strasse, Juelich 52425, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8061 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(73..120) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(160..186) /codon_start=1 /label=9xHis /note="9xHis affinity tag" /translation="HHHHHHHHH" CDS complement(193..210) /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" CDS complement(256..279) /codon_start=1 /label=HRV 3C site /note="recognition and cleavage site for human rhinovirus 3C and PreScission proteases" /translation="LEVLFQGP" CDS complement(286..309) /codon_start=1 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" /translation="WSHPQFEK" RBS complement(325..347) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" protein_bind complement(362..386) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(387..405) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 718..795 /label=lacI promoter CDS 796..1875 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1891..1912 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2451..2996 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 3591..4403 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS complement(5380..6837) /codon_start=1 /gene="repA" /product="replicase" /label=repA /protein_id="AIZ68604.1" /translation="MTLADSRDIDTPAWKFSADLFDTHPELALRSRGWTSEDRREFLAH LGRENFQGSKTRDFASAWIKDPDTGETQPKLYRVGSKSLARCQYVALTHAQHAAVLVLD IDVPSHQAGGKIEHVNPEVYAILERWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAAAG MSSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYRWHAQHNRVDRLADL MEVARMISGTEKPKKRYEQEFSSGRARIEAARKATAEAKALATLEASLPSAAEASGELI DGVRVLWTAPGRAARDETAFRHALTVGYQLKAAGERLKDTKIIDAYERAYTVAQAVGAD GREPDLPPMRDRQTMARRVRGYVAKGQPVVPARQTETQSSRGRKALATMGRRGGKKAAE RWKDPNSEYARAQREKLAKSSQRQARKAKGNRLTIAGWFMTVEGETGSWPTINEAMSEF SVSRQTVNRALKSAGIELPRGRRKASQ" gene complement(5380..6837) /gene="repA" /label=repA
This page is informational only.