Basic Vector Information
- Vector Name:
- pMK2017
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4252 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- House BL, Mortimer MW, Kahn ML.
- Promoter:
- lac UV5
pMK2017 vector Map
pMK2017 vector Sequence
LOCUS 40924_30960 4252 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pMK2017, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4252)
AUTHORS House BL, Mortimer MW, Kahn ML.
TITLE New recombination methods for Sinorhizobium meliloti genetics
JOURNAL Appl. Environ. Microbiol. 70 (5), 2806-2815 (2004)
PUBMED 15128536
REFERENCE 2 (bases 1 to 4252)
AUTHORS House BL, Mortimer MW, Kahn ML.
TITLE Direct Submission
JOURNAL Submitted (29-SEP-2003) School of Molecular Biosciences, Washington
State University, Abelson Hall Room 406A, Pullman, WA 99164, USA
REFERENCE 3 (bases 1 to 4252)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4252)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2004"; volume: "70"; issue: "5"; pages:
"2806-2815"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-SEP-2003) School of Molecular Biosciences, Washington State
University, Abelson Hall Room 406A, Pullman, WA 99164, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4252
/mol_type="other DNA"
/organism="synthetic DNA construct"
oriT complement(93..202)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
rep_origin 373..761
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
misc_feature 772..877
/label=MCS
/note="pBluescript multiple cloning site"
protein_bind 898..945
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
protein_bind 1003..1122
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 1152..1182
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 1236..1892
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
CDS 2237..2539
/codon_start=1
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
/translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
protein_bind complement(2583..2707)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
protein_bind complement(2765..2812)
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
CDS complement(2958..4145)
/codon_start=1
/label=TcR
/note="tetracycline efflux protein"
/translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVLFIM
QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
This page is informational only.