Basic Vector Information
- Vector Name:
- pMGWA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8209 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Busso D, Delagoutte-Busso B, Moras D.
pMGWA vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMGWA vector Sequence
LOCUS 40924_30795 8209 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMGWA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8209) AUTHORS Busso D, Delagoutte-Busso B, Moras D. TITLE Construction of a set Gateway-based destination vectors for high-throughput cloning and expression screening in Escherichia coli JOURNAL Anal. Biochem. 343 (2), 313-321 (2005) PUBMED 15993367 REFERENCE 2 (bases 1 to 8209) AUTHORS Busso D, Delagoutte-Busso B, Salim L, Moras D. TITLE Direct Submission JOURNAL Submitted (25-APR-2008) Structural Biology and Genomics Platform, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France REFERENCE 3 (bases 1 to 8209) TITLE Direct Submission REFERENCE 4 (bases 1 to 8209) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Anal. Biochem."; date: "2005"; volume: "343"; issue: "2"; pages: "313-321" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-APR-2008) Structural Biology and Genomics Platform, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8209 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 27..45 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 46..70 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 85..107 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 123..1220 /codon_start=1 /label=MBP /note="maltose binding protein from E. coli" /translation="KTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEE KFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLI AYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAA DGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGET AMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLE NYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFW YAVRTAVINAASGRQTVDEALKDAQT" protein_bind 1239..1363 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1388..1418 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1472..2128 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2473..2775 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2819..2943) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2957..2974 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 3041..3088 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 3125..3580 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3607..3711 /label=AmpR promoter CDS 3712..4569 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 4743..5331 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5517..5659) /label=bom /note="basis of mobility region from pBR322" CDS complement(5764..5952) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(6727..6748) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(6764..7843) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(7844..7921) /label=lacI promoter
This page is informational only.