Basic Vector Information
- Vector Name:
- pMG103
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5680 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Inui M, Roh JH, Zahn K, Yukawa H.
pMG103 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMG103 vector Sequence
LOCUS 40924_30755 5680 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pMG103 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5680)
AUTHORS Inui M, Roh JH, Zahn K, Yukawa H.
TITLE Sequence analysis of the cryptic plasmid pMG101 from
Rhodopseudomonas palustris and construction of stable cloning
vectors
JOURNAL Appl. Environ. Microbiol. 66 (1), 54-63 (2000)
PUBMED 10618203
REFERENCE 2 (bases 1 to 5680)
AUTHORS Inui M.
TITLE Direct Submission
JOURNAL Submitted (16-AUG-1999) Masayuki Inui, Research Institute of
Innovative Technology for the Earth, Molecular Microbiology and
Genetics Laboratory; 9-2, Kizugawadai, Soraku, Kizu, Kyoto 619-0292,
Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308,
Fax:81-774-75-2321)
REFERENCE 3 (bases 1 to 5680)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5680)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2000"; volume: "66"; issue: "1"; pages:
"54-63"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(16-AUG-1999) Masayuki Inui, Research Institute of Innovative
Technology for the Earth, Molecular Microbiology and Genetics
Laboratory"; volume: " 9-2, Kizugawadai, Soraku, Kizu, Kyoto
619-0292, Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308, Fax";
pages: "81-774-75-2321"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5680
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 1..27
/mol_type="other DNA"
/label=derived from cloning vector pHSG298
/note="derived from cloning vector pHSG298"
/db_xref="taxon:32630"
/organism="synthetic construct"
source 28..3080
/plasmid="pMG101"
/mol_type="other DNA"
/label=derived from 3.0-kb XhoI-SalI fragment of pMG101
/note="derived from 3.0-kb XhoI-SalI fragment of pMG101"
/db_xref="taxon:1076"
/organism="Rhodopseudomonas palustris"
CDS 3331..4143
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSKPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
primer_bind 4365..4381
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(4385..4441)
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(4451..4467)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4475..4491)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4499..4529)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4544..4565)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5037..5625)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.