Basic Vector Information
- Vector Name:
- pMFXU4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7052 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Komeda T, Tazumi K, Shimada H, Kano K, Hyashi T, Saito H, Tsumura H, Sakai Y, Kato N, Kondo K.
pMFXU4 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMFXU4 vector Sequence
LOCUS 40924_30750 7052 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMFXU4 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7052)
AUTHORS Komeda T, Tazumi K, Shimada H, Kano K, Hyashi T, Saito H, Tsumura H,
Sakai Y, Kato N, Kondo K.
TITLE Production of Active Bovine Cathepsin C (Dipeptidyl Aminopeptidase
I) in the Methylotrophic Yeast Candida boidinii
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7052)
AUTHORS Komeda T, Kondo K, Sakai Y, Kato N.
TITLE Direct Submission
JOURNAL Submitted (11-OCT-2001) Toshihiro Komeda, Central Laboratories for
Key Technology, Kirin Brewery Co., Ltd.; 1-13-5, Fukuura,
Kanazawa-ku, Yokohama, Kanagawa 236-0004, Japan
(E-mail:t-komeda@kirin.co.jp, Tel:81-45-788-7217,
Fax:81-45-788-4042)
REFERENCE 3 (bases 1 to 7052)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7052)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-OCT-2001) Toshihiro Komeda, Central Laboratories for Key
Technology, Kirin Brewery Co., Ltd."; volume: " 1-13-5, Fukuura,
Kanazawa-ku, Yokohama, Kanagawa 236-0004, Japan
(E-mail:t-komeda@kirin.co.jp, Tel:81-45-788-7217, Fax"; pages:
"81-45-788-4042"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7052
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
regulatory 425..1600
/standard_name="mFDH1"
/label=mFDH1
/regulatory_class="promoter"
misc_feature 1601
/label=NotI cloning site
/note="NotI cloning site"
regulatory 1609..2237
/standard_name="FDH1"
/label=FDH1
/regulatory_class="terminator"
CDS complement(2891..3703)
/codon_start=1
/gene="URA3"
/product="orotidine-5'-phosphate decarboxylase"
/label=URA3
/note="Candida boidinii orotidine-5'-phosphate
decarboxylase"
/protein_id="BAE72068.1"
/translation="MSETLKTQPYSKRAEVHPSPVARRLFNLMETKKTNLCASVDLTTT
KEILDLLEKVGPYICLVKTHIDIVSDFSYEGTIVPLLALAKKYNFMIFEDRKFADIGNT
VKSQYKGGVYQIAKWSDITNAHGVTGSGIVTGLKQAAEEVTDEPRGLLMLAELSSKGAI
AHGKYTEETVEIAKTDKDFVIGFIAQNQMGGSDEGFDWIIMTPGVGLDDKGDALGQQYR
TVSEVMSTGTDIIIVGRGLFGKGRDPSVEGERYMKAGWNAYLARTNQL"
gene complement(2891..3703)
/gene="URA3"
/label=URA3
primer_bind complement(4831..4847)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4855..4871)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4879..4909)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4924..4945)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5233..5821)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5995..6852)
/label=AmpR
/note="beta-lactamase"
promoter complement(6853..6957)
/label=AmpR promoter
This page is informational only.