pMFXU4 vector (V004750)

LOCUS       40924_30750        7052 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pMFXU4 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7052)
  AUTHORS   Komeda T, Tazumi K, Shimada H, Kano K, Hyashi T, Saito H, Tsumura H,
            Sakai Y, Kato N, Kondo K.
  TITLE     Production of Active Bovine Cathepsin C (Dipeptidyl Aminopeptidase 
            I) in the Methylotrophic Yeast Candida boidinii
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7052)
  AUTHORS   Komeda T, Kondo K, Sakai Y, Kato N.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2001) Toshihiro Komeda, Central Laboratories for 
            Key Technology, Kirin Brewery Co., Ltd.; 1-13-5, Fukuura, 
            Kanazawa-ku, Yokohama, Kanagawa 236-0004, Japan 
            (E-mail:t-komeda@kirin.co.jp, Tel:81-45-788-7217, 
            Fax:81-45-788-4042)
REFERENCE   3  (bases 1 to 7052)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7052)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-OCT-2001) Toshihiro Komeda, Central Laboratories for Key 
            Technology, Kirin Brewery Co., Ltd."; volume: " 1-13-5, Fukuura, 
            Kanazawa-ku, Yokohama, Kanagawa 236-0004, Japan 
            (E-mail:t-komeda@kirin.co.jp, Tel:81-45-788-7217, Fax"; pages: 
            "81-45-788-4042"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7052
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      425..1600
                     /standard_name="mFDH1"
                     /label=mFDH1
                     /regulatory_class="promoter"
     misc_feature    1601
                     /label=NotI cloning site
                     /note="NotI cloning site"
     regulatory      1609..2237
                     /standard_name="FDH1"
                     /label=FDH1
                     /regulatory_class="terminator"
     CDS             complement(2891..3703)
                     /codon_start=1
                     /gene="URA3"
                     /product="orotidine-5'-phosphate decarboxylase"
                     /label=URA3
                     /note="Candida boidinii orotidine-5'-phosphate
                     decarboxylase"
                     /protein_id="BAE72068.1"
                     /translation="MSETLKTQPYSKRAEVHPSPVARRLFNLMETKKTNLCASVDLTTT
                     KEILDLLEKVGPYICLVKTHIDIVSDFSYEGTIVPLLALAKKYNFMIFEDRKFADIGNT
                     VKSQYKGGVYQIAKWSDITNAHGVTGSGIVTGLKQAAEEVTDEPRGLLMLAELSSKGAI
                     AHGKYTEETVEIAKTDKDFVIGFIAQNQMGGSDEGFDWIIMTPGVGLDDKGDALGQQYR
                     TVSEVMSTGTDIIIVGRGLFGKGRDPSVEGERYMKAGWNAYLARTNQL"
     gene            complement(2891..3703)
                     /gene="URA3"
                     /label=URA3
     primer_bind     complement(4831..4847)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4855..4871)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4879..4909)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4924..4945)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5233..5821)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5995..6852)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(6853..6957)
                     /label=AmpR promoter