Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V004775 | pME6032 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
- Vector Name:
- pME6032
- Antibiotic Resistance:
- Tetracycline
- Length:
- 9816 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D.
pME6032 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pME6032 vector Sequence
LOCUS 40924_30560 9816 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pME6032, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9816)
AUTHORS Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U,
O'Gara F, Haas D.
TITLE Small, stable shuttle vectors based on the minimal pVS1 replicon for
use in gram-negative, plant-associated bacteria
JOURNAL Mol. Plant Microbe Interact. 13 (2), 232-237 (2000)
PUBMED 10659714
REFERENCE 2 (bases 1 to 9816)
AUTHORS Heeb S, Blumer C, Haas D.
TITLE Regulatory RNA as mediator in GacA/RsmA-dependent global control of
exoproduct formation in Pseudomonas fluorescens CHA0
JOURNAL J. Bacteriol. 184 (4), 1046-1056 (2002)
PUBMED 11807065
REFERENCE 3 (bases 1 to 9816)
AUTHORS Heeb S.
TITLE Direct Submission
JOURNAL Submitted (19-MAY-2006) Institute of Infection, Immunity and
Inflammation, University of Nottingham, Centre for Biomolecular
Sciences, Nottingham NG7 2RD, United Kingdom
REFERENCE 4 (bases 1 to 9816)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 9816)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Plant
Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages:
"232-237"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "J.
Bacteriol."; date: "2002"; volume: "184"; issue: "4"; pages:
"1046-1056"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(19-MAY-2006) Institute of Infection, Immunity and Inflammation,
University of Nottingham, Centre for Biomolecular Sciences,
Nottingham NG7 2RD, United Kingdom"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9816
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 195..881
/codon_start=1
/product="pVS1 resolvase"
/label=pVS1 resolvase
/note="ORF1; not required for stable maintenance"
/protein_id="ABG33931.1"
/translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
RQEEQA"
CDS 878..1093
/codon_start=1
/product="hypothetical protein"
/label=hypothetical protein
/note="ORF2; not required for stable maintenance"
/protein_id="ABG33932.1"
/translation="MKPHQDGQDEPFFITEEIEAEMIAAGYVFEPPAHVSTVRLHEILA
GLSDAKLAAWPASLAAEETERRRLKR"
CDS 1180..1806
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 1830..2045
/codon_start=1
/product="ParG"
/label=ParG
/note="pVS1 partitioning protein"
/protein_id="ABG33934.1"
/translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT
KLKMYAVRQGKTITELLSEYIAQLPE"
CDS 2238..3308
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 3377..3571
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 4281..4826
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
oriT 5068..5089
/label=p15A origin of transfer
/note="p15A origin of transfer"
regulatory 5148..5414
/label=T4 transcription terminator
/note="T4 transcription terminator"
/regulatory_class="terminator"
misc_feature 5402..5421
/note="sequencing oligonucleotide P6032:
5'-CCCTCACTGATCCGCTAGTC-3'"
misc_feature 5416..5473
/label=multiple cloning site
/note="multiple cloning site"
regulatory complement(5478..5481)
/regulatory_class="ribosome_binding_site"
protein_bind complement(5490..5506)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
misc_feature complement(5509)
/label=start of transcription
/note="start of transcription"
promoter complement(5514..5542)
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
promoter 5776..5853
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 5977..6792
/codon_start=1
/product="LacIQ repressor"
/label=LacIQ repressor
/note="tac promoter repressor"
/protein_id="ABG33936.1"
/translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR
ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA
LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY
LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR
VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR"
CDS complement(7824..8471)
/label=TetR
/note="tetracycline resistance regulatory protein"
CDS 8577..9773
/label=TcR
/note="tetracycline efflux protein"