Basic Vector Information
- Vector Name:
- pME-loxP-mCherry-pA-loxP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3554 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Sztal TE, Zhao M, Williams C, Oorschot V, Parslow AC, Giousoh A, Yuen M, Hall TE, Costin A, Ramm G, Bird PI, Busch-Nentwich EM, Stemple DL, Currie PD, Cooper ST, Laing NG, Nowak KJ, Bryson-Richardson
pME-loxP-mCherry-pA-loxP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pME-loxP-mCherry-pA-loxP vector Sequence
LOCUS 40924_30505 3554 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pME-loxP-mCherry-pA-loxP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3554) AUTHORS Sztal TE, Zhao M, Williams C, Oorschot V, Parslow AC, Giousoh A, Yuen M, Hall TE, Costin A, Ramm G, Bird PI, Busch-Nentwich EM, Stemple DL, Currie PD, Cooper ST, Laing NG, Nowak KJ, Bryson-Richardson RJ. TITLE Zebrafish models for nemaline myopathy reveal a spectrum of nemaline bodies contributing to reduced muscle function JOURNAL Acta Neuropathol. 130 (3), 389-406 (2015) PUBMED 25931053 REFERENCE 2 (bases 1 to 3554) AUTHORS Hall TE. TITLE Cre-lox in zebrafish JOURNAL Unpublished REFERENCE 3 (bases 1 to 3554) AUTHORS Hall TE. TITLE Direct Submission JOURNAL Submitted (21-OCT-2013) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia REFERENCE 4 (bases 1 to 3554) TITLE Direct Submission REFERENCE 5 (bases 1 to 3554) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Acta Neuropathol."; date: "2015"; volume: "130"; issue: "3"; pages: "389-406" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (21-OCT-2013) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..3554 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..668 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" misc_recomb 669..702 /label=LoxP /note="LoxP" protein_bind 669..702 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." CDS 709..1416 /codon_start=1 /label=mCherry /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" /translation="MVSKGEDDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" promoter complement(1435..1452) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" polyA_signal complement(1457..1591) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" protein_bind complement(1645..1678) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind complement(1679..1778) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1796..1814) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1819..1835) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1948..2754 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2904..3492 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.