pME-Cavin1a-MO-Control vector (V004795)

MSDS

Basic Vector Information

Vector Name:: pME-Cavin1a-MO-Control

Antibiotic Resistance:: Kanamycin

Length:: 3311 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Lo HP, Nixon SJ, Hall TE, Cowling BS, Ferguson C, Morgan GP, Schieber NL, Fernandez-Rojo MA, Bastiani M, Floetenmeyer M, Martel N, Laporte J, Pilch PF, Parton RG.

pME-Cavin1a-MO-Control vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pME-Cavin1a-MO-Control vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_30455        3311 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pME-Cavin1a-MO-Control, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3311)
  AUTHORS   Lo HP, Nixon SJ, Hall TE, Cowling BS, Ferguson C, Morgan GP, 
            Schieber NL, Fernandez-Rojo MA, Bastiani M, Floetenmeyer M, Martel 
            N, Laporte J, Pilch PF, Parton RG.
  TITLE     The caveolin-cavin system plays a conserved and critical role in 
            mechanoprotection of skeletal muscle
  JOURNAL   J. Cell Biol. 210 (5), 833-849 (2015)
  PUBMED    26323694
REFERENCE   2  (bases 1 to 3311)
  AUTHORS   Lo H, Hall TE, Parton RG.
  TITLE     The role of Cavin1 in zebrafish
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 3311)
  AUTHORS   Hall TE, Parton RG.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2014) Institute for Molecular Bioscience, 
            University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, 
            Australia
REFERENCE   4  (bases 1 to 3311)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 3311)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Cell 
            Biol."; date: "2015"; volume: "210"; issue: "5"; pages: "833-849"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (18-JUL-2014) Institute for Molecular Bioscience, University of 
            Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3311
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(268..295)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(387..473)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     537..553
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    569..668
                     /label=attL1
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    669..715
                     /label=zf Cavin1a 5' URS
                     /note="zf Cavin1a 5' URS"
     CDS             716..1432
                     /codon_start=1
                     /label=EGFP
                     /note="enhanced GFP"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     protein_bind    complement(1436..1535)
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        complement(1553..1571)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1576..1592)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1705..2511
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      2661..3249
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.