Basic Vector Information
- Vector Name:
- pMDC21
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6135 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Shao Y.
- Promoter:
- sacB
pMDC21 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMDC21 vector Sequence
LOCUS 40924_30430 6135 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMDC21, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6135) AUTHORS Shao Y. TITLE Establishment of markerless gene deletion system in Chromohalobacter salexigens JOURNAL Unpublished REFERENCE 2 (bases 1 to 6135) AUTHORS Shao Y. TITLE Direct Submission JOURNAL Submitted (27-DEC-2016) College of Life Science, Qingdao Agricultural University, The Great Wall Road, No. 700, Qingdao, Shandong 266109, China REFERENCE 3 (bases 1 to 6135) TITLE Direct Submission REFERENCE 4 (bases 1 to 6135) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-DEC-2016) College of Life Science, Qingdao Agricultural University, The Great Wall Road, No. 700, Qingdao, Shandong 266109, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6135 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 565..667 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 668..1324 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter 1602..2047 /label=sacB promoter /note="sacB promoter and control region" CDS 2048..3466 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVSEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" oriT complement(3823..3932) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter complement(4167..4257) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" promoter complement(4451..4541) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 4901..5489 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 5777..5798 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5813..5843 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 5851..5867 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 5875..5891 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 5900..5956 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(5960..5976) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.