pMD.SD.Gad vector (V004802)

LOCUS       V004802                 9376 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004802
VERSION     V004802
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9376)
  AUTHORS   Dharmasena MN, Stark CEC., Stibitz S, Kopecko DJ.
  TITLE     Acid-resistant, attenuated microbial vector for improved oral
            delivery of multiple targeted antigens
  JOURNAL   Patent: US WO/2015/021147-B 12-FEB-2015; FDA-Center for Biologics
            Evaluation and Research; NIH campus Bldg. 29, 8800 Rockville Pike;
            Laboratory of Enteric and Sexually Transmitted Diseases; Bethesda,
            MD; USA;
REFERENCE   2  (bases 1 to 9376)
  AUTHORS   Dharmasena MN, Stark CEC., Stibitz S, Kopecko DJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAY-2014) Laboratory of Enteric and Sexually
            Transmitted Diseases, FDA-Center for Biologics Evaluation and
            Research, NIH Campus Bldg. 29, 8800 Rockville Pike, Bethesda, MD
            20892, USA
REFERENCE   3  (bases 1 to 9376)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9376)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Patent: US
            WO/2015/021147-B 12-FEB-2015; FDA-Center for Biologics Evaluation
            and Research; NIH campus Bldg. 29, 8800 Rockville Pike; Laboratory
            of Enteric and Sexually Transmitted Diseases; Bethesda, MD; USA;"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (16-MAY-2014) Laboratory of Enteric and Sexually Transmitted
            Diseases, FDA-Center for Biologics Evaluation and Research, NIH
            Campus Bldg. 29, 8800 Rockville Pike, Bethesda, MD 20892, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9376
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             411..1202
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"
     protein_bind    complement(1396..1429)
                     /label="FRT (minimal)"
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="supports FLP-mediated excision but not integration
                     (Turan and Bode, 2011)"
     CDS             1500..1973
                     /codon_start=1
                     /product="tviD"
                     /label="tviD"
                     /protein_id="AJS13705.1"
                     /translation="MSITLSFQNASMNKLFEKECRNVATRALKYVRQKKTEGRLDEALS
                     VLISLKRIEPDVSRLMREYKQIIRLFNESRKDGGSTITSYEHLDYAKKLLVFDSENAYA
                     LKYAALNAMHLRDYTQALQYWQRLEKVNGPTEPVTRQISTCITALQKNTSGKS"
     CDS             complement(2043..2918)
                     /label="araC"
                     /note="L-arabinose regulatory protein"
     promoter        2945..3229
                     /label="araBAD promoter"
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite
                     direction (Guzman et al., 1995)"
     CDS             3257..4654
                     /gene="gadA"
                     /label="Glutamate decarboxylase alpha"
                     /note="Glutamate decarboxylase alpha from Escherichia coli
                     (strain K12). Accession#: P69908"
     CDS             4706..6103
                     /gene="gadB"
                     /label="Glutamate decarboxylase beta"
                     /note="Glutamate decarboxylase beta from Escherichia coli
                     (strain K12). Accession#: P69910"
     CDS             6128..7660
                     /gene="gadC"
                     /label="Glutamate/gamma-aminobutyrate antiporter"
                     /note="Glutamate/gamma-aminobutyrate antiporter from
                     Escherichia coli (strain K12). Accession#: P63235"
     protein_bind    complement(7709..7756)
                     /label="FRT"
                     /note="FLP-mediated recombination occurs in the 8-bp core
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     CDS             complement(7950..8318)
                     /label="traJ"
                     /note="oriT-recognizing protein"
     oriT            complement(8351..8460)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"
     rep_origin      8620..9008
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     terminator      9144..9230
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      9322..9349
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"