Basic Vector Information
- Vector Name:
- pMCG50-S
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4625 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Krieg AM, Wu T, Weeratna R, Efler SM, Love-Homan L, Yang L, Yi AK, Short D, Davis HL.
pMCG50-S vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMCG50-S vector Sequence
LOCUS 40924_29971 4625 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMCG50-S, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4625)
AUTHORS Krieg AM, Wu T, Weeratna R, Efler SM, Love-Homan L, Yang L, Yi AK,
Short D, Davis HL.
TITLE Sequence motifs in adenoviral DNA block immune activation by
stimulatory CpG motifs
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12631-12636 (1998)
PUBMED 9770537
REFERENCE 2 (bases 1 to 4625)
AUTHORS Wu T, Efler SM, Davis HL, Krieg AM, Schorr J.
TITLE Direct Submission
JOURNAL Submitted (12-MAR-1998) HGD, Loeb Health Research Institute, 725
Parkdale Ave., Ottawa, ON K1Y 4E9, Canada
REFERENCE 3 (bases 1 to 4625)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4625)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "1998"; volume: "95"; issue: "21"; pages:
"12631-12636"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-MAR-1998) HGD, Loeb Health Research Institute, 725 Parkdale
Ave., Ottawa, ON K1Y 4E9, Canada"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4625
/mol_type="other DNA"
/organism="synthetic DNA construct"
polyA_signal 77..284
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
primer_bind complement(312..328)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(336..352)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
protein_bind complement(407..428)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(716..1304)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1450..2256)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
primer_bind 3170..3186
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3193..3211
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(3226..3242)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
enhancer 3271..3650
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 3651..3854
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 3926..4603
/codon_start=1
/label=HBsAg (S)
/note="major/small (S) envelope protein of hepatitis B
virus"
/translation="MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGML
PVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLW
EWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCL
WVYI"
This page is informational only.