Basic Vector Information
- Vector Name:
- pMBP-parallel1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6724 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Sheffield P, Garrard S, Derewenda Z.
pMBP-parallel1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMBP-parallel1 vector Sequence
LOCUS 40924_29906 6724 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMBP-parallel1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6724) AUTHORS Sheffield P, Garrard S, Derewenda Z. TITLE Overcoming expression and purification problems of RhoGDI using a family of 'parallel' expression vectors JOURNAL Protein Expr. Purif. 15 (1), 34-39 (1999) PUBMED 10024467 REFERENCE 2 (bases 1 to 6724) AUTHORS Sheffield PJ, Garrard SM, Derewenda ZS. TITLE Direct Submission JOURNAL Submitted (05-OCT-1998) Molecular Physiology and Biological Physics, University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park Avenue, Charlottesville, Virginia 22908, USA REFERENCE 3 (bases 1 to 6724) TITLE Direct Submission REFERENCE 4 (bases 1 to 6724) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Protein Expr. Purif."; date: "1999"; volume: "15"; issue: "1"; pages: "34-39" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-OCT-1998) Molecular Physiology and Biological Physics, University of Virginia, 4215 Jordan Hall, 1300 Jefferson Park Avenue, Charlottesville, Virginia 22908, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6724 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 3..80 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 81..1160 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1176..1197 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1406..1434 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 1442..1458 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1528..2628 /codon_start=1 /label=MBP /note="maltose binding protein from E. coli" /translation="MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLE EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKL IAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGE TAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL ENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAF WYAVRTAVINAASGRQTVDEALKDAQT" misc_feature 2633..2688 /gene="malE" /label=protein spacer region /note="protein spacer region" CDS 2689..2709 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" misc_feature 2711..2810 /gene="malE" /label=multiple cloning site /note="multiple cloning site" primer_bind complement(2814..2830) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 3179..3265 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3357..3384 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 3404..3495 /label=AmpR promoter CDS 3496..4353 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin complement(4398..4911) /direction=LEFT /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 5022..5610 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5796..5936) /label=bom /note="basis of mobility region from pBR322" CDS complement(6041..6229) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.