Basic Vector Information
- Vector Name:
- pMB18424
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6419 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Batista MB.
- Promoter:
- sacB
pMB18424 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMB18424 vector Sequence
LOCUS 40924_29876 6419 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMB18424, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6419) AUTHORS Batista MB. TITLE pMB18424, a new tetA-sacB vector for counterselection in bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 6419) AUTHORS Batista MB. TITLE Direct Submission JOURNAL Submitted (14-FEB-2018) Molecular Microbiology, John Innes Centre, Colney Laney, Norwich, Norfolk NR4 7PH, United Kingdom REFERENCE 3 (bases 1 to 6419) TITLE Direct Submission REFERENCE 4 (bases 1 to 6419) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-FEB-2018) Molecular Microbiology, John Innes Centre, Colney Laney, Norwich, Norfolk NR4 7PH, United Kingdom" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6419 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 709..732 /label=M13 F(-47) /note="M13 F(-47)" primer_bind 736..752 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 762..780 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(789..896) /label=MCS /note="pBluescript multiple cloning site" promoter complement(909..927) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(948..964) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(972..988) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(996..1026) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1041..1062) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(1224..2411) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(2459..2487) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" promoter 2519..2964 /label=sacB promoter /note="sacB promoter and control region" CDS 2965..4383 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVSEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" oriT complement(4705..4814) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter complement(5049..5139) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" promoter complement(5333..5423) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 5783..6371 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.