Basic Vector Information
- Vector Name:
- pMARS-mODC-AZ
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5742 bp
- Type:
- Episomal vector
- Replication origin:
- ori
- Source/Author:
- Kitsera N, Khobta A, Epe B.
- Promoter:
- RSV
pMARS-mODC-AZ vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMARS-mODC-AZ vector Sequence
LOCUS 40924_29806 5742 bp DNA circular SYN 18-DEC-2018
DEFINITION Episomal vector pMARS-mODC-AZ, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5742)
AUTHORS Kitsera N, Khobta A, Epe B.
TITLE Destabilized green fluorescent protein detects rapid removal of
transcription blocks after genotoxic exposure
JOURNAL BioTechniques 43 (2), 222-227 (2007)
PUBMED 17824390
REFERENCE 2 (bases 1 to 5742)
AUTHORS Khobta A, Kitsera N, Epe B.
TITLE Direct Submission
JOURNAL Submitted (23-JAN-2008) Institute of Pharmacy, Johannes Gutenberg
University of Mainz, Staudingerweg 5, Mainz 55099, Germany
REFERENCE 3 (bases 1 to 5742)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5742)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"BioTechniques"; date: "2007"; volume: "43"; issue: "2"; pages:
"222-227"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(23-JAN-2008) Institute of Pharmacy, Johannes Gutenberg University
of Mainz, Staudingerweg 5, Mainz 55099, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5742
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 61..364
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 365..568
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 613..1329
/codon_start=1
/label=EGFP
/note="enhanced GFP"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
polyA_signal 2372..2493
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(2500..2955)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2982..3086
/label=AmpR promoter
promoter 3306..3567
/label=RSV promoter
/note="Rous sarcoma virus enhancer/promoter"
CDS 3638..4429
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 4664..4711
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 5040..5628
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.