Basic Vector Information
- Vector Name:
- pLZ44
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3626 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
pLZ44 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLZ44 vector Sequence
LOCUS 40924_29566 3626 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pLZ44, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3626)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Chromosomal expression of foreign and native genes from regulatable
promoters in Escherichia coli
JOURNAL Methods Mol. Biol. 267, 123-134 (2004)
PUBMED 15269420
REFERENCE 2 (bases 1 to 3626)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Direct Submission
JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University,
Lilly Hall, West Lafayette, IN 47907, USA
REFERENCE 3 (bases 1 to 3626)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3626)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods
Mol. Biol. 267, 123-134 (2004)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall,
West Lafayette, IN 47907, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3626
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 50..136
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 228..255
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
protein_bind complement(357..376)
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
promoter 391..421
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
protein_bind 429..445
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 467..1180
/codon_start=1
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
FICTTGKLPVPWPTLVTTFAYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
FVTAAGITHGMDELYK"
terminator 1267..1513
/label=lambda tL3 terminator
/note="transcription terminator tL3 from phage lambda"
protein_bind 1527..1844
/label=phage Phi-80 attP
/note="attachment site of phage phi-80"
rep_origin complement(1955..2343)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
CDS complement(2494..3150)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(3151..3253)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
misc_feature 3450..3626
/label=oriT2
/note="oriT2"
This page is informational only.