Basic Vector Information
- Vector Name:
- pLZ44
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3626 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
pLZ44 vector Map
pLZ44 vector Sequence
LOCUS 40924_29566 3626 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pLZ44, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3626)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Chromosomal expression of foreign and native genes from regulatable
promoters in Escherichia coli
JOURNAL Methods Mol. Biol. 267, 123-134 (2004)
PUBMED 15269420
REFERENCE 2 (bases 1 to 3626)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Direct Submission
JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University,
Lilly Hall, West Lafayette, IN 47907, USA
REFERENCE 3 (bases 1 to 3626)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3626)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods
Mol. Biol. 267, 123-134 (2004)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall,
West Lafayette, IN 47907, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3626
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 50..136
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 228..255
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
protein_bind complement(357..376)
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
promoter 391..421
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
protein_bind 429..445
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 467..1180
/codon_start=1
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
FICTTGKLPVPWPTLVTTFAYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
FVTAAGITHGMDELYK"
terminator 1267..1513
/label=lambda tL3 terminator
/note="transcription terminator tL3 from phage lambda"
protein_bind 1527..1844
/label=phage Phi-80 attP
/note="attachment site of phage phi-80"
rep_origin complement(1955..2343)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
CDS complement(2494..3150)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(3151..3253)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
misc_feature 3450..3626
/label=oriT2
/note="oriT2"
This page is informational only.