Basic Vector Information
- Vector Name:
- pLZ43
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3729 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
- Promoter:
- rhaB
pLZ43 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLZ43 vector Sequence
LOCUS 40924_29561 3729 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLZ43, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3729) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Chromosomal expression of foreign and native genes from regulatable promoters in Escherichia coli JOURNAL Methods Mol. Biol. 267, 123-134 (2004) PUBMED 15269420 REFERENCE 2 (bases 1 to 3729) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Direct Submission JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA REFERENCE 3 (bases 1 to 3729) TITLE Direct Submission REFERENCE 4 (bases 1 to 3729) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods Mol. Biol. 267, 123-134 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3729 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 50..136 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 228..255 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 425..543 /label=rhaB promoter /note="promoter of the E. coli rhaBAD operon, conferring tight induction with L-rhamnose and repression with D-glucose in the presence of RhaR and RhaS (Giacalone et al., 2006)" CDS 573..1286 /codon_start=1 /label=yeGFP /note="yeast-enhanced green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFAYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" terminator 1370..1616 /label=lambda tL3 terminator /note="transcription terminator tL3 from phage lambda" protein_bind 1630..1947 /label=phage Phi-80 attP /note="attachment site of phage phi-80" rep_origin complement(2058..2446) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(2597..3253) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3254..3356) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" misc_feature 3553..3729 /label=oriT2 /note="oriT2"
This page is informational only.