Basic Vector Information
- Vector Name:
- pLZ42
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3890 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
pLZ42 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLZ42 vector Sequence
LOCUS 40924_29556 3890 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLZ42, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3890) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Chromosomal expression of foreign and native genes from regulatable promoters in Escherichia coli JOURNAL Methods Mol. Biol. 267, 123-134 (2004) PUBMED 15269420 REFERENCE 2 (bases 1 to 3890) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Direct Submission JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA REFERENCE 3 (bases 1 to 3890) TITLE Direct Submission REFERENCE 4 (bases 1 to 3890) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods Mol. Biol. 267, 123-134 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3890 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 50..136 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 228..255 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind complement(357..376) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." promoter 391..421 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind 429..445 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter 475..579 /label=AmpR promoter CDS 580..1437 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" terminator 1531..1777 /label=lambda tL3 terminator /note="transcription terminator tL3 from phage lambda" protein_bind 1791..2108 /label=phage Phi-80 attP /note="attachment site of phage phi-80" rep_origin complement(2219..2607) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(2758..3414) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3415..3517) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" misc_feature 3714..3890 /label=oriT2 /note="oriT2"
This page is informational only.