Basic Vector Information
- Vector Name:
- pLZ41
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3993 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
- Promoter:
- rhaB
pLZ41 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLZ41 vector Sequence
LOCUS 40924_29551 3993 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pLZ41, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3993)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Chromosomal expression of foreign and native genes from regulatable
promoters in Escherichia coli
JOURNAL Methods Mol. Biol. 267, 123-134 (2004)
PUBMED 15269420
REFERENCE 2 (bases 1 to 3993)
AUTHORS Zhou L, Zhang K, Wanner BL.
TITLE Direct Submission
JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University,
Lilly Hall, West Lafayette, IN 47907, USA
REFERENCE 3 (bases 1 to 3993)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3993)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods
Mol. Biol. 267, 123-134 (2004)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall,
West Lafayette, IN 47907, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3993
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 50..136
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 228..255
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 425..543
/label=rhaB promoter
/note="promoter of the E. coli rhaBAD operon, conferring
tight induction with L-rhamnose and repression with
D-glucose in the presence of RhaR and RhaS (Giacalone et
al., 2006)"
promoter 581..685
/label=AmpR promoter
CDS 686..1543
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
terminator 1634..1880
/label=lambda tL3 terminator
/note="transcription terminator tL3 from phage lambda"
protein_bind 1894..2211
/label=phage Phi-80 attP
/note="attachment site of phage phi-80"
rep_origin complement(2322..2710)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
CDS complement(2861..3517)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(3518..3620)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
misc_feature 3817..3993
/label=oriT2
/note="oriT2"
This page is informational only.