pLZ1 vector (V004868)

LOCUS       40924_29541        4712 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pLZ1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4712)
  AUTHORS   Zhu L, Klenner C, Kuhn A, Dalbey RE.
  TITLE     Both YidC and SecYEG are required for translocation of the 
            periplasmic loops 1 and 2 of the multispanning membrane protein TatC
  JOURNAL   J. Mol. Biol. 424 (5), 354-367 (2012)
  PUBMED    23058713
REFERENCE   2  (bases 1 to 4712)
  AUTHORS   Zhu L, Wasey A, White SH, Dalbey RE.
  TITLE     Charge composition features of model single-span membrane proteins 
            that determine selection of YidC and SecYEG translocase pathways in 
            Escherichia coli
  JOURNAL   J. Biol. Chem. 288 (11), 7704-7716 (2013)
  PUBMED    23355473
REFERENCE   3  (bases 1 to 4712)
  AUTHORS   Zhu L, Kaback HR, Dalbey RE.
  TITLE     YidC protein, a molecular chaperone for LacY protein folding via the
            SecYEG protein machinery
  JOURNAL   J. Biol. Chem. 288 (39), 28180-28194 (2013)
  PUBMED    23928306
REFERENCE   4  (bases 1 to 4712)
  AUTHORS   Soman R, Yuan J, Kuhn A, Dalbey RE.
  TITLE     The polarity and charge of the periplasmic loop determines the YidC 
            and Sec translocase requirement for the M13 procoat lep protein
  JOURNAL   J. Biol. Chem. (2013) In press
  PUBMED    24275657
REFERENCE   5  (bases 1 to 4712)
  AUTHORS   Zhu L, Dalbey R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2013) Department of Chemistry and Biochemistry, 
            The Ohio State University, RM580, W. 12th Ave., Columbus, OH 43210, 
            USA
REFERENCE   6  (bases 1 to 4712)
  TITLE     Direct Submission
REFERENCE   7  (bases 1 to 4712)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Mol. 
            Biol."; date: "2012"; volume: "424"; issue: "5"; pages: "354-367"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "J. Biol. 
            Chem."; date: "2013"; volume: "288"; issue: "11"; pages: "7704-7716"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "J. Biol. 
            Chem."; date: "2013"; volume: "288"; issue: "39"; pages: 
            "28180-28194"
COMMENT     SGRef: number: 4; type: "Journal Article"; journalName: "J. Biol. 
            Chem. (2013) In press"
COMMENT     SGRef: number: 5; type: "Journal Article"; journalName: "Submitted 
            (29-NOV-2013) Department of Chemistry and Biochemistry, The Ohio 
            State University, RM580, W. 12th Ave., Columbus, OH 43210, USA"
COMMENT     SGRef: number: 6; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4712
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        20..38
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    39..63
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        197..227
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     protein_bind    235..251
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     complement(397..413)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     terminator      604..651
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     terminator      704..790
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      882..909
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      1009..1057
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     terminator      1119..1167
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     CDS             1313..1357
                     /codon_start=1
                     /label=S-Tag
                     /note="affinity and epitope tag derived from pancreatic 
                     ribonuclease A"
                     /translation="KETAAAKFERQHMDS"
     terminator      1409..1456
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     CDS             complement(1689..2501)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     promoter        complement(2502..2593)
                     /label=AmpR promoter
     rep_origin      complement(2609..3358)
                     /direction=LEFT
                     /label=RSF ori
                     /note="Plasmids containing the RSF 1030 origin of
                     replication can be propagated in E. coli cells that contain
                     additional plasmids with compatible origins."
     protein_bind    complement(3516..3537)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             complement(3553..4632)
                     /codon_start=1
                     /label=lacI
                     /note="lac repressor"
                     /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
                     YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
                     ALADSLMQLARQVSRLESGQ"
     promoter        complement(4633..4710)
                     /label=lacI promoter