Basic Vector Information
- Vector Name:
- pLOI2228
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3508 bp
- Type:
- Integration vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Martinez-Morales F, Borges AC, Martinez A, Shanmugam KT, Ingram LO.
pLOI2228 vector Map
pLOI2228 vector Sequence
LOCUS 40924_28576 3508 bp DNA circular SYN 18-DEC-2018
DEFINITION Integration vector pLOI2228, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3508)
AUTHORS Martinez-Morales F, Borges AC, Martinez A, Shanmugam KT, Ingram LO.
TITLE Chromosomal integration of heterologous DNA in Escherichia coli with
precise removal of markers and replicons used during construction
JOURNAL J. Bacteriol. 181 (22), 7143-7148 (1999)
PUBMED 10559184
REFERENCE 2 (bases 1 to 3508)
AUTHORS Borges AC, Martinez-Morales F, Ingram LO, Shanmugam KT.
TITLE Direct Submission
JOURNAL Submitted (28-JUL-1999) Microbiology and Cell Science, University of
Florida, 981 Museum Road, Room 1160, Gainesville, FL 32611-0700, USA
REFERENCE 3 (bases 1 to 3508)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3508)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J.
Bacteriol."; date: "1999"; volume: "181"; issue: "22"; pages:
"7143-7148"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(28-JUL-1999) Microbiology and Cell Science, University of Florida,
981 Museum Road, Room 1160, Gainesville, FL 32611-0700, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3508
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 17..50
/label=FRT (minimal)
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
promoter 86..104
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 112..182
/label=multiple cloning site
/note="multiple cloning site"
protein_bind 214..248
/label=flipase binding site
/bound_moiety="flipase"
/note="flipase-binding site"
protein_bind 216..249
/label=FRT (minimal)
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
CDS complement(415..1362)
/codon_start=1
/label=Rep101(Ts)
/note="temperature-sensitive version of the RepA protein
needed for replication with the pSC101 origin (Armstrong et
al., 1984)"
/translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE
RTVSFTYNQYVQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS
SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI
EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV
ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLRNGLRKTLHDALTAKIQLTSFEAKF
LSDMQSKHDLNGSFSWLTQKQRTTLENILAKYGRI"
rep_origin complement(1410..1632)
/direction=LEFT
/label=pSC101 ori
/note="low-copy replication origin that requires the Rep101
protein"
CDS complement(2553..3209)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(3210..3312)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
This page is informational only.