Basic Vector Information
- Vector Name:
- pLH6500
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9393 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Hausmann L, Toepfer R.
- Promoter:
- CaMV 35S
pLH6500 vector Map
pLH6500 vector Sequence
LOCUS 40924_28247 9393 bp DNA circular SYN 18-DEC-2018
DEFINITION Binary vector pLH6500, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9393)
AUTHORS Hausmann L, Toepfer R.
TITLE Development of Plasmid Vectors
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9393)
AUTHORS Hausmann L, Toepfer R.
TITLE Direct Submission
JOURNAL Submitted (12-FEB-2003) Institute for Grapevine Breeding
Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE 3 (bases 1 to 9393)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9393)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof,
Siebeldingen 76833, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9393
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 80..424
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
misc_difference 447
/gene="hph"
/gene_synonym="hpt; hyg"
/replace="g"
/label=compared to GenBank accesion Number K01193
/note="compared to GenBank accesion Number K01193"
CDS 452..1474
/label=HygR
/note="aminoglycoside phosphotransferase from E. coli"
regulatory 1503..1702
/note="terminator sequence from the 35S gene of Cauliflower
mosaic virus in GenBank Accession Numbers X05868 and
V00140"
/regulatory_class="terminator"
misc_difference 1541
/label=compared to GenBank Accession Number X05868
/note="compared to GenBank Accession Number X05868"
/experiment="experimental evidence, no additional details
recorded"
regulatory 1668..1683
/regulatory_class="polyA_signal_sequence"
misc_feature 1698
/label=putative transcription stop site
/note="putative transcription stop site"
misc_feature 1721..1822
/note="multiple cloning site from vector pBlueSfi AB in
GenBank Accession Number AF327874"
regulatory 1792..1801
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
misc_difference 1848
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature 1867..1891
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
repeat_region 1915..1927
/label=repeat C'
/note="repeat C'"
misc_difference 1921
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
repeat_region 1950..1961
/label=repeat C
/note="repeat C"
repeat_region 1975..1985
/label=repeat B
/note="repeat B"
repeat_region 2002..2012
/label=repeat B
/note="repeat B"
misc_difference 2007
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 2018
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature complement(2035..2425)
/note="3' sequence of the ornithine cyclodeaminase gene
ocd; non-functional"
misc_difference 2211
/replace="t"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
rep_origin 2536..3124
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_difference 3222..3223
/replace="gta"
/label=compared to GenBank Accession Number J01749
/note="compared to GenBank Accession Number J01749"
/experiment="experimental evidence, no additional details
recorded"
misc_feature complement(3309..3449)
/label=bom
/note="basis of mobility region from pBR322"
regulatory 3737..3742
/regulatory_class="minus_35_signal"
regulatory 3763..3768
/regulatory_class="minus_10_signal"
regulatory 3785..3789
/regulatory_class="ribosome_binding_site"
CDS 3799..4485
/codon_start=1
/product="resolvase"
/label=resolvase
/note="resolvase-like protein encoded by parR of plasmid
pVS1; similar to Tn3 resolvase in GenBank Accession Number
V00613, Tn917 resolvase in GenBank Accession Number M11180,
and RK2 ParA in GenBank Accession Number L27758"
/protein_id="AAO85356.1"
/translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
RQEEQA"
misc_difference 4218
/replace="c"
/note="original nucleotide changed to destroy a SfiI
restriction site"
/experiment="experimental evidence, no additional details
recorded"
stem_loop 4629..4661
/label=palindromic sequence
/note="palindromic sequence"
misc_difference 4637
/replace="g"
/note="nucleotide changed to conserve palindromic sequence
following SfiI restriction site-destruction"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 4652
/replace="c"
/note="original nucleotide changed to destroy two SfiI
restriction sites"
/experiment="experimental evidence, no additional details
recorded"
regulatory 4719..4724
/regulatory_class="minus_35_signal"
regulatory 4740..4745
/regulatory_class="minus_10_signal"
regulatory 4773..4780
/regulatory_class="ribosome_binding_site"
CDS 4784..5410
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
misc_feature 5680..5692
/note="identical to the korB operator binding site of
plasmid RK2 in GenBank Accession Number L27758.1"
CDS 5842..6912
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
stem_loop 6929..6951
/label=palindromic sequence
/note="palindromic sequence"
rep_origin 6981..7175
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
repeat_region 7272..7285
/label=repeat E
/rpt_unit_range=7272 .. 7278
/note="repeat E"
regulatory 7516..7521
/regulatory_class="minus_35_signal"
regulatory 7539..7544
/regulatory_class="minus_10_signal"
CDS 7780..8568
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
stem_loop 8574..8631
/note="palindromic sequence; putative termination signal"
misc_difference 8808..8809
/replace="ggtacc"
/note="compared to GenBank Accession Number X00493; removed
to destroy a KpnI restriction site"
misc_feature 9091..9115
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.